KEGG   Arcobacter sp. LPB0137: LPB137_02210Help
Entry
LPB137_02210      CDS       T04722                                 

Definition
(GenBank) aldehyde dehydrogenase
  KO
K13821  RHH-type transcriptional regulator, proline utilization regulon repressor / proline dehydrogenase / delta 1-pyrroline-5-carboxylate dehydrogenase [EC:1.5.5.2 1.2.1.88]
Organism
alp  Arcobacter sp. LPB0137
Pathway
alp00250  Alanine, aspartate and glutamate metabolism
alp00330  Arginine and proline metabolism
alp01100  Metabolic pathways
alp01110  Biosynthesis of secondary metabolites
alp01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:alp00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    LPB137_02210
   00330 Arginine and proline metabolism
    LPB137_02210
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:alp03000]
    LPB137_02210
Enzymes [BR:alp01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.88  L-glutamate gamma-semialdehyde dehydrogenase
     LPB137_02210
  1.5  Acting on the CH-NH group of donors
   1.5.5  With a quinone or similar compound as acceptor
    1.5.5.2  proline dehydrogenase
     LPB137_02210
Transcription factors [BR:alp03000]
 Prokaryotic Type
  Ribbon-helix-helix
   Other families
    LPB137_02210
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh Pro_dh
Motif
Other DBs
NCBI-ProteinID: APW64740
UniProt: A0A1P8KJL6
Position
440701..444270
Genome map
AA seq 1189 aa AA seqDB search
MKKEQELVNSAVTLACKWQNRATELVSDFDREFYVKMNKMLEQPKDKALLIELMDQCFRA
ESNARIADQICFLLEKHGMAHFFTTKDKTLLYLFQNIGKYLPNISVPLFVNQIREDTKTV
VIKGEEEIFNAHLKKRKSEGTRVNINLIGEVVLGEQEAGERMEKYIKALENPNVDYISIK
ISTIFSQINPLNFENVVDVLVAKLTLIYEAAQKNQYVTNSGEKRDKFINLDMEEYRDLAI
TVEVFKRTLEKPQFQSLYAGIVLQAYLPDSFLWQKDLCDWARNRVQNGGSPIKFRLVKGA
NMEMEETEASQKHWEMVTYVDKADTDSNYKRMVRYALDKDNAPFMHIGTASHNLFELAFA
TVMADENGTSEYHTLEMLEGMSESARLAIKEISKEVILYAPTASKEQFTNAIAYLVRRLD
ENTGPNNFIRYSFGLKVASKDWKMQENLFRESFEVEKTSFVGSKRVQNRLDEKWDNYSNS
SFDTNSYHAEADTDFILEKNHEWAANIVKKWKNTKDTVHTIAPVVVGGEDLVGDRKIFDA
IDKCQVEDGVLAGRFALANKEDINKAVAVAKADVDGWRDLTHAQRHEILKAVAIKMRERR
DNLIGVASAEVGKVFTETDVEVSEAIDFVEFYTHAIRHFDDYENLEVSAKGVGVVVPPWN
FPIAIPVGGVASALAAGNTVIIKPASVAALCSYEMCKCFWDAGISKNVLQFLPCPGALAG
EHLIPNKDIDFLILTGGEDTAATMLETRNDLFLSAETGGKDATIVTNMADREQAVKNVCQ
SAFGNSGQKCSATSLLVLEDEVYNDAGFKKALIDTASSMNVGSIWDMKNRIGTLANKVSG
NLERALNELEGNETWALKPEYVDGNPYMLKPSIKWGVEEGNFIHMNELFGPVLAVIKASD
LEHAVKIVNATGYGLTSGIESLDEREIEYWKENLEAGNLYINRGTTGAIVLRQPFGGMGK
SAIGAGRKAGFYNYVTQFVDIKETQNPKSLKVYNTELTKFIDNCVSTHNNQEDFKKLSIA
LQSYYSNFETEFSQEKDYAKVRGEDNHFRYLPLDNVLIRVSSEDTLFESISRILAAKVSG
VRFKVSIEDNKLIQSFLENSKELFGARDGLVSQTDDEMIKSMDKFDRVIYSDISKVSDVV
FKKSAQTLTFIVRQKPMMEGRLELLNYFIEQSISHSFHRYGNIGARDLA
NT seq 3570 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaagaacaagaacttgtaaattctgctgtaactcttgcttgtaaatggcaaaat
agagcaactgaacttgtgagtgattttgatagagaattttatgtaaagatgaataagatg
cttgaacaaccaaaagataaagcacttttaattgagcttatggatcagtgttttagagct
gaatcaaatgcaagaatagcagatcagatttgttttttattagaaaaacatggaatggca
catttttttacaacaaaagataaaacgcttttatacctattccaaaatataggtaaatat
ttacctaatatttctgttccattatttgtaaatcaaattagagaagatactaaaactgta
gtaattaagggtgaagaagagatctttaatgcacatcttaagaaaagaaaatctgaagga
actagagtaaatatcaaccttattggggaagtagtcttaggagagcaagaagcgggtgag
cgaatggaaaaatatataaaggcattagagaatccaaatgttgattatatttctattaaa
atatctactattttttcacaaattaatcctttaaattttgaaaatgttgttgatgtatta
gttgctaagcttactttaatttatgaagccgcacaaaagaatcaatatgtaacaaactct
ggtgaaaagagagataagttcattaatcttgatatggaagagtaccgagatttagctatt
actgttgaagtatttaaaagaactttagaaaagccacaatttcaaagcctttatgctggt
attgtattacaagcttatttacctgattcctttctttggcaaaaagatttatgtgattgg
gcaagaaatagagtacaaaatggtggatctcctattaagtttagacttgttaagggtgct
aatatggagatggaagaaacagaagcctctcaaaaacattgggaaatggttacttatgta
gataaagctgacactgattcaaattataaaagaatggttagatatgcactggataaagac
aatgctccatttatgcatataggaacagcatctcacaatttatttgaattagcatttgct
actgtaatggcagatgagaatggaacaagtgaatatcatacattagaaatgttagaaggt
atgagtgaatctgcaagattagcaattaaagaaatttctaaagaagtgattttatatgca
cctactgcatcaaaagaacaatttacaaatgcaattgcatatttagtgcgaagacttgat
gaaaatactggtccaaataactttattagatattcatttggattaaaagttgcttcaaaa
gactggaaaatgcaagaaaatctttttagagaatcttttgaagttgaaaaaacatctttt
gtaggttctaaaagagttcaaaatagattagacgaaaaatgggacaattattcaaactct
tcttttgatacaaactcttaccatgcagaagctgatactgattttattttagaaaaaaat
catgaatgggctgctaatattgttaaaaaatggaaaaacactaaagatactgttcataca
attgcccctgttgttgtaggtggagaagatttagtaggtgatcgtaaaatttttgatgct
attgataaatgtcaagttgaagatggtgtattagcaggtagatttgccttagcaaataaa
gaagatattaataaagctgttgcagttgcaaaggctgatgttgatggttggagagattta
actcatgcacaaagacatgaaatattaaaagcagttgcaattaaaatgcgtgaaagaaga
gataatttaattggagtagcttcagctgaagttggtaaagtatttactgaaactgatgta
gaagtatctgaagcaattgattttgttgaattctatactcatgcaattagacactttgat
gattatgaaaatcttgaagttagtgcaaaaggtgttggtgtagttgttcctccttggaat
ttccctattgcaattcccgttggtggagtagcatcagcattagcagctggtaatactgtt
attattaaacctgcttctgttgctgctttatgttcttatgaaatgtgtaaatgtttctgg
gatgctgggatttcaaaaaatgttttacaatttcttccttgtccaggagcacttgcagga
gagcatttaattccaaataaagatattgacttcttaatcttaacaggtggtgaagataca
gctgcaacaatgttagaaactagaaatgatttattcttatcggctgaaactggtggaaaa
gatgccacaattgttacaaatatggcagatagagaacaagctgttaaaaatgtatgtcaa
agtgcatttggaaactctggtcaaaaatgttcagcaacttctttacttgtattagaagat
gaagtttataacgacgcagggtttaaaaaggcattaattgatacggcaagctcaatgaat
gtaggttctatttgggacatgaaaaatagaatcggaacattagctaataaagtaagtggt
aacctagaacgggcacttaatgagcttgaaggtaatgaaacttgggctttaaaaccagaa
tatgttgatggtaacccttatatgttaaaaccatcaattaaatggggagttgaggaaggt
aactttattcacatgaatgaattatttggacctgtattagcagttattaaagcaagtgat
ttagaacatgcagttaaaatagtaaatgcaactggatatggattaacttccggaattgaa
tctttagatgaaagagaaatagaatattggaaagaaaatcttgaagctggtaacctttat
ataaatagaggaactacaggtgcaatagttttacgacaaccatttggtggaatgggtaaa
tctgcaattggagcagggagaaaagctggtttctataactatgttactcaatttgttgat
ataaaagaaactcaaaatccaaaaagtttaaaagtatataatactgaattaactaaattt
attgataactgtgttagtactcataataatcaagaagatttcaagaaattaagtattgca
ctacaatcatattattctaactttgaaacagagttctcacaagagaaagattatgcaaag
gtaagaggtgaagataaccactttagatatttacctttagataatgtacttattagagta
tcaagtgaggatacattatttgaatcaatctcaagaatcttagctgcaaaagtatcagga
gttagatttaaagtttctattgaagataataaattaattcaatcattcctagagaattca
aaagaattatttggtgcacgtgacggtttagtttctcaaacagatgatgaaatgattaag
tcaatggataaatttgatagagtaatttattcggatatttcaaaagtatcagatgtagtg
tttaagaaatctgcccaaacattaacttttatagtaagacaaaaaccaatgatggaagga
agactagagcttcttaattacttcattgaacaatcaatctcacactctttccatagatat
ggaaatattggtgctagggatttagcttaa

DBGET integrated database retrieval system