KEGG   Arcobacter sp. LPB0137: LPB137_09490Help
Entry
LPB137_09490      CDS       T04722                                 

Definition
(GenBank) 7-alpha-hydroxysteroid dehydrogenase
  KO
K00076  7-alpha-hydroxysteroid dehydrogenase [EC:1.1.1.159]
Organism
alp  Arcobacter sp. LPB0137
Pathway
alp00121  Secondary bile acid biosynthesis
Brite
KEGG Orthology (KO) [BR:alp00001]
 09100 Metabolism
  09103 Lipid metabolism
   00121 Secondary bile acid biosynthesis
    LPB137_09490
Enzymes [BR:alp01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.159  7alpha-hydroxysteroid dehydrogenase
     LPB137_09490
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR
Motif
Other DBs
NCBI-ProteinID: APW66073
UniProt: A0A1P8KNI8
Position
1901200..1901979
Genome map
AA seq 259 aa AA seqDB search
MSESMKNKTLVISGGTKGIGKECVYKFAQNGVNVAFTYNSNQQFAEDICKDVEEKYGVKC
KAYPFNILEPEKYKELFLEIDKDFDRVDFFISNAMIYGRAVVGGYGKFMKLKPRGLNNIY
TATVNAFVCGSQQAAKRMEKVGGGAIVSLSSTGNLVYIPNYSGHGTNKAAVEAMVRYAAT
ELGEMNIRVNAVSGGPIDTDALKAFTNYEEVKQKTIDLSALKRIGQPKDLAQSCYFLCTE
EASWITSQTLVVDGGTTFR
NT seq 780 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaatctatgaaaaataaaactttagtaatttctggtggtacaaaaggtatcggt
aaagagtgtgtttataaatttgcacaaaatggtgttaatgtagcatttacatataattca
aaccaacaatttgctgaagacatttgtaaagatgtagaagaaaaatatggtgtaaaatgt
aaagcatatccttttaatattttagagccagaaaaatataaagaattatttttagaaatt
gacaaagattttgatagagttgatttctttatctcaaatgcaatgatttatggacgtgct
gttgttggtggttatggtaagtttatgaaattaaaaccaagaggtttaaataatatttat
actgctacggttaatgcatttgtatgtggttcacagcaagctgcaaaaagaatggaaaaa
gtaggcggtggagcaattgtttctttatcttcaactggtaacttagtatatattccaaac
tattcaggacatggaacaaataaagcagcagtagaagcaatggtaagatatgcagctaca
gagttaggtgaaatgaatattagagtaaatgcagtatctggtggtccaattgacactgat
gcactaaaagcctttacaaactatgaagaagttaaacaaaaaacaattgatttatcagct
ttaaaaagaattggtcaaccaaaagatttagcacaatcttgttacttcttatgtacagaa
gaagcttcttggattacatctcaaactttagttgttgatggtggaacaactttcagataa

DBGET integrated database retrieval system