KEGG   Arcobacter sp. LPB0137: LPB137_09820Help
Entry
LPB137_09820      CDS       T04722                                 

Definition
(GenBank) ADP-glyceromanno-heptose 6-epimerase
  KO
K03274  ADP-L-glycero-D-manno-heptose 6-epimerase [EC:5.1.3.20]
Organism
alp  Arcobacter sp. LPB0137
Pathway
alp00540  Lipopolysaccharide biosynthesis
alp01100  Metabolic pathways
Module
alp_M00064  ADP-L-glycero-D-manno-heptose biosynthesis
Brite
KEGG Orthology (KO) [BR:alp00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    LPB137_09820
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:alp01005]
    LPB137_09820
Enzymes [BR:alp01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.20  ADP-glyceromanno-heptose 6-epimerase
     LPB137_09820
Lipopolysaccharide biosynthesis proteins [BR:alp01005]
 Unusual sugar
  LPB137_09820
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Epimerase GDP_Man_Dehyd Polysacc_synt_2 3Beta_HSD NAD_binding_4 RmlD_sub_bind Ldh_1_N P2_N adh_short KR
Motif
Other DBs
NCBI-ProteinID: APW66130
UniProt: A0A1P8KNK7
Position
1958488..1959495
Genome map
AA seq 335 aa AA seqDB search
MKYTDINFNNKTILITGGAGFIGSNLAFYFQNYYPDAKIIILDSFRNNETFSNGNLKSFG
HFKNLLGFKGHVISGDINDKKLLEDLEENYSFDYIFHQAAISDTTVNEQDLMIQTNVNAY
EDLLKIAIKHNANVVYASSAATYGDSNRFEVGYESPNNAYGFSKVMMDNITNEYLKKDLN
ISIVGLKYFNVYGPREFFKNKTSSMVVQFGHQILKGLTPKLFEGSDKILRDFIYIEDVIQ
ANIKACNPKKSGVYNVGTGKARSFEDIVDILQSELNIDKGKEYIKNPFIGSYQFFTQANI
EDTQKYLDYKPRYEMEEGIKEYIPEIKRLFKEEVK
NT seq 1008 nt NT seq  +upstreamnt  +downstreamnt
gtgaaatacactgatataaactttaataacaaaacaattttaataactggaggagcagga
tttattggttcaaatcttgctttttactttcaaaattattaccctgatgcaaaaattata
atcttagactcttttagaaataatgagacattttcaaatggtaacctaaaaagttttggt
cactttaaaaatcttttaggatttaaaggtcatgttattagtggtgatattaatgataaa
aaactattagaagatttagaagagaattattcttttgattatatttttcatcaagctgct
atttctgatacaacagtgaatgaacaagatttaatgatacaaacaaatgtaaatgcttat
gaagatttattaaaaattgcaattaagcataatgcaaatgtagtttatgcaagttcagct
gcaacttatggtgatagtaatcgctttgaagttggatatgagtcaccaaataatgcctat
ggtttttcaaaagtaatgatggataatatcacaaatgaatatctaaaaaaagatttaaat
atttcaattgttggattaaaatattttaatgtatatggtccaagagagttttttaaaaac
aaaacttcttcaatggtagttcaatttggacatcaaatattaaaaggacttactcctaaa
ctttttgagggaagtgacaaaatattacgagattttatttatattgaagatgtaatacaa
gcaaatataaaagcttgtaatcctaagaaatctggagtttataatgtgggaacaggaaaa
gctagaagttttgaagatattgtagatattttgcaaagtgaactaaatattgataaggga
aaagaatatattaaaaatccatttattggttcttatcaattttttacacaagctaatatt
gaagatacacaaaaatacttagattataaaccaaggtatgaaatggaagaaggcattaaa
gagtatattcctgaaataaaaagactatttaaagaagaagtaaaataa

DBGET integrated database retrieval system