KEGG   Arcobacter sp. LPB0137: LPB137_12400Help
Entry
LPB137_12400      CDS       T04722                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
alp  Arcobacter sp. LPB0137
Pathway
alp00780  Biotin metabolism
alp01100  Metabolic pathways
Module
alp_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:alp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    LPB137_12400
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:alp01007]
    LPB137_12400
Enzymes [BR:alp01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     LPB137_12400
Amino acid related enzymes [BR:alp01007]
 Aminotransferase (transaminase)
  Class II
   LPB137_12400
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: APW66595
UniProt: A0A1P8KPY3
Position
2521044..2522138
Genome map
AA seq 364 aa AA seqDB search
MYSKELSSIKKSNRFRTREIFSKDIIDLASNDYLGLSTNKDIFQKAYERVLKEQYTSPKA
SMLVNGYNQIHKDFEDLLCKTNKFQAGVAVGSGFLANIAMIEALCRKNDTLFIDEDYHAS
GILATKLLKPEQVVVFKHNDSLDLENKILQNTRSGRNIVAIEGVYSMGGDLAPIELFHIQ
EKYNTLLLVDEAHSSGVIGDNLLGIFDHYKIKPNKYHIKMGTLGKAYGSYGAYILASNEI
IDFLVNRAKPIIYSTAPSLFDIALGFESLKYIIENKKTLKEKINENLTIIRTILGIKSNS
LIIPIDIGDNKKVKQIQAVLQEKSYLVGAIRQPTVKSAIIRLIAKIDINENDLTKVCQVL
KELK
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
ttgtattcaaaagaactatcatctatcaaaaaatcaaatcgttttagaactcgagaaata
ttttcaaaagatataattgatcttgcatcaaatgattatttaggcttatctacgaataaa
gatattttccaaaaagcttatgaaagagtactaaaagagcaatacacttcaccaaaagct
tctatgcttgtaaatggctacaatcaaattcataaagattttgaagatcttttatgtaaa
acaaataagtttcaagcaggtgtagctgttggttctggatttctagcaaacattgcaatg
attgaagcattatgtagaaaaaatgatactttatttattgatgaagattatcatgcaagt
ggaatacttgccactaaacttttaaaaccagaacaagtagttgtatttaaacataatgat
tcacttgacttagaaaataaaattttacaaaacactagaagtggtagaaatatcgtagca
attgaaggtgtttattctatgggtggagatttagcacccatagaattatttcatattcaa
gaaaaatataataccctacttttagttgatgaagctcatagttcaggtgtaattggcgat
aatttactaggtatatttgaccattataaaattaaacctaataagtatcatattaaaatg
ggcacacttggtaaagcttatggctcttatggtgcatatatattagcttcaaatgaaatc
atagattttttagtaaatagagcaaagccaataatttactcaactgctccttcccttttt
gatatagcactaggctttgaatcattaaaatatataattgaaaataaaaaaactctaaaa
gaaaagataaatgagaatttaactattatacgtactatattaggtataaaatctaatagt
ttaattatccctattgatataggtgataataaaaaagtaaaacaaatacaagctgtttta
caagaaaaatcatacctagttggtgcaattagacaaccgactgttaaaagtgcgattata
cggctaattgcaaaaatagatattaatgaaaatgacttaaccaaggtatgtcaagtttta
aaggaattaaaatga

DBGET integrated database retrieval system