KEGG   Arcobacter sp. LPB0137: LPB137_13860Help
Entry
LPB137_13860      CDS       T04722                                 

Definition
(GenBank) FAD-dependent oxidoreductase
  KO
K03153  glycine oxidase [EC:1.4.3.19]
Organism
alp  Arcobacter sp. LPB0137
Pathway
alp00730  Thiamine metabolism
alp01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alp00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    LPB137_13860
Enzymes [BR:alp01000]
 1. Oxidoreductases
  1.4  Acting on the CH-NH2 group of donors
   1.4.3  With oxygen as acceptor
    1.4.3.19  glycine oxidase
     LPB137_13860
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DAO NAD_binding_8 NAD_binding_2 ApbA UDPG_MGDP_dh_N F420_oxidored 3HCDH_N FAD_binding_3
Motif
Other DBs
NCBI-ProteinID: APW67024
UniProt: A0A1P8KR33
Position
complement(2843095..2844186)
Genome map
AA seq 363 aa AA seqDB search
MNIAIVGTGLVGRVLALNLLKDGHNLTLFDKHGKDGVKAAGFTAAGMLAPFAELETAESI
IFDLGVRSIALWPDLLKKVGVYDGFQLAGTIITSHPQDLNELEHFIATLKNKVKEAKEID
FINKEELKELEPELNNYNKSFYIKNEGQVDSQRFISFSTNYLQNHPNVIWKDFTEVDKIE
EGSVYIENKKEEFDWVFDSRGLGAKEHFKDLRGVRGEVLWLESNDINITRPTRLLHPRYK
IYIVPRQKGCEGIDLEYCSDCKITQSKGSIRYIVGATEIESEDTSPISVRSSLELLSAVF
TVHPSFGEARVVNTETNCRPAFKDNLPRIENSHKLTRINGLYRHGYLLAPAIVEKALKEG
IYK
NT seq 1092 nt NT seq  +upstreamnt  +downstreamnt
atgaatatagcaatagtaggtacaggtttagtaggtagagttttagcacttaatctatta
aaagatggtcataacttaactttatttgataaacatggtaaagatggtgttaaagcagct
ggttttacagcagctggaatgttagcaccttttgctgaacttgaaactgctgaatcaata
atttttgatttaggagttcgttctattgctttatggccagacttactaaaaaaagtagga
gtatatgatggttttcaattagcaggaacaattataacctcacatccacaagatttaaat
gaacttgaacattttatagctactcttaaaaataaagtaaaagaagccaaagagattgat
tttataaataaagaagagttaaaagagcttgagcctgaattaaataactataataaatcc
ttttatattaaaaatgaaggtcaagtagattcacaacgttttatctcattttctactaac
tatttgcaaaatcatcctaatgtaatatggaaagattttactgaagttgataaaattgaa
gaaggtagtgtctatattgagaataaaaaagaagagtttgattgggtttttgattcaaga
ggtttaggagctaaagaacattttaaagatttaagaggagtaagaggtgaggttttatgg
ttagaatcaaatgatattaatatcacaagaccaacaagattacttcacccaagatataaa
atctatatagtaccaaggcaaaaaggctgtgaaggaattgatttagaatattgtagtgat
tgtaaaatcacacaatctaagggttcaatacgttatatagtaggtgcaacagaaattgaa
agtgaagatactagtcctatttcagtacgttcttctttagagcttttatcagctgttttt
acagttcatccaagttttggagaagcacgtgttgttaatacagaaactaattgtcgtcct
gcatttaaagataatttacctagaatagaaaatagtcataaacttacaagaatcaatggt
ctttatagacatggatatttattagcccctgcaattgtggaaaaggcattaaaggaagga
atatataaatga

DBGET integrated database retrieval system