KEGG   Alteromonas sp. RKMC-009: DS731_00250Help
Entry
DS731_00250       CDS       T05653                                 

Gene name
coaBC
Definition
(GenBank) bifunctional phosphopantothenoylcysteine decarboxylase/phosphopantothenate--cysteine ligase CoaBC
  KO
K13038  phosphopantothenoylcysteine decarboxylase / phosphopantothenate---cysteine ligase [EC:4.1.1.36 6.3.2.5]
Organism
alr  Alteromonas sp. RKMC-009
Pathway
alr00770  Pantothenate and CoA biosynthesis
alr01100  Metabolic pathways
Module
alr_M00120  Coenzyme A biosynthesis, pantothenate => CoA
Brite
KEGG Orthology (KO) [BR:alr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    DS731_00250 (coaBC)
Enzymes [BR:alr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.36  phosphopantothenoylcysteine decarboxylase
     DS731_00250 (coaBC)
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.5  phosphopantothenate---cysteine ligase (CTP)
     DS731_00250 (coaBC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DFP Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AYA62564
UniProt: A0A385MQA7
Position
complement(54559..55764)
Genome map
AA seq 401 aa AA seqDB search
MHLFNKKILLGVTGGIAAYKTPDLVRKLKAQGSDVRVVLTRGATEFVSSLSLQAVSGHQV
HSELLDEQAEAGMGHIELAKWADVLLIAPATAHCMAKLAHGLADDLLSTLYLATTAQVFI
APAMNQQMWQARATQDNLQKLQLRAIRFIGPAAGEQACGDVGPGRMEEPELIVSALASAL
TGNKLEGKKVVITAGPTREPIDPVRYLSNHSSGKMGYAVAQAAAEQGAEVVLVSGPVSLT
VPPGIKRISVQTADDMLEAVMSEINSAQIFIAAAAVADYRINHQAENKIKKSDDKLTLTF
VKNPDILKTVAALPSPPFTVGFAAESQNVEAYARGKLENKNLDMIAANDITLEGLGFNSD
ENALHVIWKEDDVQLPPANKTELAKSLIALVAKQYNNKQSN
NT seq 1206 nt NT seq  +upstreamnt  +downstreamnt
atgcacttattcaataaaaaaattcttctgggtgttaccggcggtattgccgcctataaa
acaccggatctggtaagaaaactgaaagcgcagggctctgacgtgagagtggtactgaca
cgtggtgcaacagaatttgtcagttcattatcgttacaggcggtttccggccatcaggtt
cacagcgagttgctggacgagcaggccgaagccggaatgggtcatatcgaactggcgaaa
tgggccgatgttttgttgattgcaccggccacggcgcactgcatggctaaactggcgcat
ggcctggcagatgatctgctttcaacattgtaccttgcaaccactgctcaggttttcatt
gctcctgccatgaatcagcaaatgtggcaggcacgggcaacgcaggataacctgcaaaaa
ttgcaacttcgtgccatccgtttcatcgggccggcagcgggcgaacaggcatgtggcgat
gtgggaccgggcagaatggaagaaccggaacttatcgtatcagcattagccagtgccctg
accggtaataagctggaaggtaaaaaagttgtcattactgcgggaccaaccagagagccc
attgacccggtcagatacctatcgaatcacagcagtggcaaaatgggatacgccgtagcg
caggctgcggctgagcagggcgcagaggttgtgctggtgtccggcccggtttccctgaca
gtaccccccgggataaaacgcatcagtgtgcaaactgctgatgacatgctcgaagcagtt
atgagtgagatcaactcagcgcaaatcttcattgcagcggcagccgttgccgattatcgt
attaaccatcaggcagaaaataagatcaaaaaatctgatgataagttaacacttactttt
gttaaaaaccctgatattcttaagactgtagctgcattaccctctccgccatttacggta
gggtttgctgctgaaagccagaatgtggaagcttatgcacggggcaaattagaaaataaa
aacctcgacatgattgctgcgaatgacatcaccctggaagggcttggctttaatagtgac
gaaaatgcgctgcatgtcatctggaaagaggatgacgtacagttgcctccggcgaataaa
acagagttagccaaatcgctaatcgcgctggttgcaaaacaatataataataaacaatca
aattaa

DBGET integrated database retrieval system