KEGG   Alteromonas sp. RKMC-009: DS731_00305Help
Entry
DS731_00305       CDS       T05653                                 

Definition
(GenBank) 3-deoxy-D-manno-octulosonic acid kinase
  KO
K11211  3-deoxy-D-manno-octulosonic acid kinase [EC:2.7.1.166]
Organism
alr  Alteromonas sp. RKMC-009
Pathway
alr00540  Lipopolysaccharide biosynthesis
Brite
KEGG Orthology (KO) [BR:alr00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00540 Lipopolysaccharide biosynthesis
    DS731_00305
Enzymes [BR:alr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.166  3-deoxy-D-manno-octulosonic acid kinase
     DS731_00305
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Kdo RIO1 Pkinase APH Pkinase_Tyr
Motif
Other DBs
NCBI-ProteinID: AYA62573
UniProt: A0A385MQA5
Position
complement(63583..64296)
Genome map
AA seq 237 aa AA seqDB search
MAIKQVSAGSHHILTCADEYPQITPQWFDPQWWQEKGAVNGQAKGRGTTLFLDVDGEALV
LRHYRRGGLPGKLLDDQYVFGGLEATRPFKELRLLSAMRDQGLNVPRPVAAHVQRSGLVY
RGDLITAMIPESQDLHAVLCRQPLPEDRWFATGVAVARMHRAGVYHHDLNVRNVMIDSRE
EIWIIDFDRCDFRAGDKWKTRNVARFLRSLVKEKNKHAGFHWQQSDWNAFLEGLQSV
NT seq 714 nt NT seq  +upstreamnt  +downstreamnt
atggcgataaaacaagtgtcagcaggcagtcaccatatcctgacctgcgcagatgaatat
ccgcaaattacaccgcagtggtttgacccgcaatggtggcaggaaaaaggtgcagttaac
ggtcaggcgaaaggccggggaaccacgttatttctggacgtagacggagaggcgcttgtg
ctgcgccattatcgtcgcggcggattaccgggcaagttgcttgacgaccagtatgtgttt
ggcggacttgaggcaacacgtccctttaaagaacttcgtttgctgtcagccatgcgtgac
cagggtttgaacgtcccccgcccggtggccgcacatgtacagcgcagtggtctggtatac
cgtggggatttaattaccgcaatgattcctgagagtcaggatctgcatgctgtgctatgc
cgccaaccgttaccggaagacagatggttcgccacaggtgttgccgtagccagaatgcac
cgtgccggtgtgtaccatcacgatttgaatgtgagaaatgtgatgatagatagtcgggaa
gaaatctggatcattgattttgatcgctgtgacttccgcgccggcgataaatggaaaacc
cgaaacgtggcgcgttttttacgctcactggttaaagaaaaaaataagcatgccggattt
cactggcagcaaagcgactggaatgcctttcttgagggcttgcaatctgtgtga

DBGET integrated database retrieval system