KEGG   Alteromonas sp. RKMC-009: DS731_02535Help
Entry
DS731_02535       CDS       T05653                                 

Gene name
ubiG
Definition
(GenBank) bifunctional 2-polyprenyl-6-hydroxyphenol methylase/3-demethylubiquinol 3-O-methyltransferase UbiG
  KO
K00568  2-polyprenyl-6-hydroxyphenyl methylase / 3-demethylubiquinone-9 3-methyltransferase [EC:2.1.1.222 2.1.1.64]
Organism
alr  Alteromonas sp. RKMC-009
Pathway
alr00130  Ubiquinone and other terpenoid-quinone biosynthesis
alr01100  Metabolic pathways
alr01110  Biosynthesis of secondary metabolites
Module
alr_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:alr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    DS731_02535 (ubiG)
Enzymes [BR:alr01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.64  3-demethylubiquinol 3-O-methyltransferase
     DS731_02535 (ubiG)
    2.1.1.222  2-polyprenyl-6-hydroxyphenol methylase
     DS731_02535 (ubiG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Methyltransf_23 Methyltransf_25 Methyltransf_11 Methyltransf_31 Methyltransf_12 CMAS MTS NodS PrmA Methyltransf_PK Ubie_methyltran DREV TehB Methyltransf_16 MetW Methyltransf_32 NAS
Motif
Other DBs
NCBI-ProteinID: AYA62972
UniProt: A0A385MT50
Position
583031..583795
Genome map
AA seq 254 aa AA seqDB search
MLDKSQLSPPVATANVNAQEIARFDALADAWWDPDGKYKTALSFNAARVDFIEQAINKHF
RPKGLADALFEGLSVLDVGSGGGLICEPLAKRGADVTGIDASATSVEVARRHALKQNLPV
SYHHCLAGEWADKGQQYDVVINAEVVEHVPDQQTLIQECASMVKPGGLLILATLNRTFRS
FIVAIVGAEYVMRYLPVGTHSWSKFVKPEELDSWTGSQFVRHTQSGFKLNPLTGHWKTTP
SMAVNYLCCYKKQP
NT seq 765 nt NT seq  +upstreamnt  +downstreamnt
atgttagataaaagtcagttaagcccaccggttgcgacagcgaatgtgaacgctcaggaa
atcgcccgctttgatgcgctggctgatgcatggtgggatcctgacggaaaatataaaacc
gcgctgtctttcaatgccgcccgggtagattttatcgaacaggcaatcaataagcatttt
cgccctaagggattggcggatgcattgtttgagggtttatctgtattggacgttggcagt
ggcggcgggttgatttgcgagcctctggctaaacgtggcgcagacgtgaccggcattgat
gccagtgcgaccagtgtcgaagttgcaagacggcatgcactgaagcaaaacttgccggta
agctaccaccattgcctggccggtgaatgggcagataaaggacaacagtatgatgtggtt
atcaatgctgaggtggtagaacatgtacctgatcagcaaacgctgattcaggaatgcgcc
tccatggttaaaccgggcgggttactcattctggcaaccttaaaccgtacttttcgcagt
tttattgttgctatagtgggggccgaatatgttatgcgctatctgccggtgggtacgcac
agctggtcaaagttcgtgaaacctgaggagcttgacagctggacaggcagtcagtttgta
cgtcacacacaaagcgggtttaagcttaacccgctcaccggacactggaaaaccacgcct
tccatggcggtaaactatctctgctgctataaaaagcagccctga

DBGET integrated database retrieval system