KEGG   Alteromonas sp. RKMC-009: DS731_04220Help
Entry
DS731_04220       CDS       T05653                                 

Gene name
apaG
Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
alr  Alteromonas sp. RKMC-009
Brite
KEGG Orthology (KO) [BR:alr00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    DS731_04220 (apaG)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525
Motif
Other DBs
NCBI-ProteinID: AYA63271
UniProt: A0A385MS16
Position
complement(967683..968060)
Genome map
AA seq 125 aa AA seqDB search
MQASPGIIVSVSTRHLPDHPASGPDKYAFAYHITIRNHSDARVQLLSRYWLITDGNGKNT
EVQGEGVVGKKPHIDPASEYQYTSGALLDTPVGSMQGHYEMENESGQRFRVPIHIFSLSV
PNALN
NT seq 378 nt NT seq  +upstreamnt  +downstreamnt
atgcaggcatcgccaggcattatcgtctccgtttccacacggcacctgccggatcacccg
gccagcgggcctgacaaatacgcctttgcttaccacattactatccgtaaccacagtgat
gcccgcgttcagttgctgagccgctactggcttatcaccgacggtaacggtaagaatact
gaagttcagggtgaaggggttgttggcaaaaagccccatatcgacccggcaagtgaatat
cagtataccagtggcgcattactggatacgcctgtgggcagtatgcagggccattacgaa
atggaaaatgaaagcggtcagcgttttcgtgtgcccattcatatattcagcttaagtgtg
ccgaacgcgctcaattag

DBGET integrated database retrieval system