KEGG   Alteromonas sp. RKMC-009: DS731_09485Help
Entry
DS731_09485       CDS       T05653                                 

Definition
(GenBank) NADP-dependent isocitrate dehydrogenase
  KO
K00031  isocitrate dehydrogenase [EC:1.1.1.42]
Organism
alr  Alteromonas sp. RKMC-009
Pathway
alr00020  Citrate cycle (TCA cycle)
alr00480  Glutathione metabolism
alr01100  Metabolic pathways
alr01110  Biosynthesis of secondary metabolites
alr01120  Microbial metabolism in diverse environments
alr01130  Biosynthesis of antibiotics
alr01200  Carbon metabolism
alr01210  2-Oxocarboxylic acid metabolism
alr01230  Biosynthesis of amino acids
Module
alr_M00009  Citrate cycle (TCA cycle, Krebs cycle)
alr_M00010  Citrate cycle, first carbon oxidation, oxaloacetate => 2-oxoglutarate
Brite
KEGG Orthology (KO) [BR:alr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    DS731_09485
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DS731_09485
Enzymes [BR:alr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.42  isocitrate dehydrogenase (NADP+)
     DS731_09485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IDH
Motif
Other DBs
NCBI-ProteinID: AYA64204
UniProt: A0A385MUA0
Position
2145607..2147832
Genome map
AA seq 741 aa AA seqDB search
MTKAKSTIIYTKTDEAPMLATYSLLPIIEKFAKSADIDIELSDISLAARILANFPDYLND
DQKVPDALTDLGEKTQDPEANIIKLPNISASIPQLRAAIKELNAKGYNVPPFPEDPKTDE
EKDIRERYGKVLGSAVNPVLREGNSDRRAPTAVKNFAKKHPHSMGEWSQASRSHVAHMRG
GDFYSSEKSTTVEKDGYVSIEFTGKDGSKKTLKPRVDLLAGEVIDGMFMSKKALCKFFEE
QIEDAKQTGILFSLHVKATMMKVSHPIVFGHCVKVFYKELFDKHGDLFKELGVNPNNGLG
SVYDKIASLPESQRSEIEKDINACYADRPPMAMVNSDKGISNLHVPSDVIVDASMPAMIR
NSGQMWGPDGKAHDTKAVIPESTYATIYQEVINFCKTHGAFDPTTMGTVPNVGLMAQKAE
EYGSHDKTFELEADGTVQIIDQDGNVLIEHNVEEGDIWRMCQAKDAPIQDWVKLAVTRAR
NSGMPAVFWLDDERAHDAQLIKKVEKYLKDHDTNGLEIHIMSPVRAIRFSMERAIRGLDT
ISVTGNVLRDYLTDLFPILELGTSAKMLSIVPLMAGGGLYETGAGGSAPKHIQQFVEEGH
LRWDSLGEFLALAVSLEELAIKHSNSKAKALAVALDKATEKLLNTGKSPERKVGQLDNRG
SHVWLALYWAEALTEQTEDKELAELFKPTLEAMTANIDKIIEEIDASQGQPQDIGGYYFP
DEDKLYAAMSPSKTLQESLSK
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaagctaagtcgactatcatctacacaaaaacagatgaagcgccaatgctggcg
acttactctttactgccaatcattgagaaatttgctaaatctgctgacatcgacatcgag
ttaagcgatatttcactggctgcgcgtattctcgccaacttcccggattacctgaacgac
gatcaaaaagtgcctgacgcactgactgacctgggtgaaaaaacgcaggatccagaagca
aacatcattaaactgcctaacatcagtgcatctattccccaattgcgtgcagcaatcaaa
gaattaaacgccaaaggctataacgttcctccgttccctgaagatcctaaaacggacgaa
gaaaaagacatccgtgaacgttacggaaaagtactgggttctgctgttaacccggttctg
cgtgaaggtaactcagaccgccgtgcacctacagcggttaaaaacttcgcgaagaaacac
ccgcattcaatgggtgagtggagccaggcttcacgctctcacgttgcgcacatgcgcggc
ggcgatttctactcaagtgagaagtccactactgttgagaaagatggctacgtaagcatc
gaatttaccggtaaagacggtagcaagaaaaccctgaagccacgtgtagatctgctggcg
ggtgaagttatcgacggtatgttcatgagcaagaaagccctgtgcaaattcttcgaagaa
caaatcgaagatgcgaagcaaaccggcattctgttctcactacacgtgaaagcgaccatg
atgaaggtgtctcaccccatcgtattcggtcactgcgtaaaagtgttttataaagaactg
ttcgacaagcacggcgatctgtttaaagaactgggtgttaaccctaacaatggtttaggc
agcgtttacgacaaaatcgcttctctgccggaatcacagcgttctgaaatcgaaaaagac
atcaacgcctgttacgctgaccgtccgcctatggcaatggttaactcagacaaaggtatt
tctaacctgcacgtaccttcagacgttatcgttgatgcgtctatgcctgcaatgatccgt
aacagcggtcagatgtggggaccggatggtaaggcgcacgatactaaagcggttatcccc
gagtctacttatgcgactatctatcaggaagtgattaacttctgtaagacccacggtgca
tttgatcctactaccatgggtacagtgcctaacgttggtctgatggcgcagaaagcggaa
gagtacggttcacacgataagacatttgaactggaagctgacggtactgtacaaatcatc
gatcaggacggaaatgtgctgattgagcacaatgttgaagaaggcgatatctggcgtatg
tgtcaggcgaaagacgcgccgattcaggattgggttaaactggccgttacccgtgcacgt
aactctggtatgccggcagtattctggctggacgatgagcgtgcccacgatgcacagctt
atcaagaaagttgagaagtacctgaaagaccacgacacgaatggtctggaaatccacatc
atgtcacctgtacgtgcgattcgtttctctatggaacgtgcaatccgcggcctggatact
atctccgtaacaggtaacgttctgcgtgactatctgactgacctgttcccgattctggaa
ctgggtaccagtgcgaagatgctgtctatcgtgcctctgatggccggtggtggtctgtac
gagaccggtgcgggtggttctgcacctaagcacattcagcagttcgttgaagaaggtcac
ttacgctgggattcactgggtgaattcctggcactggcagtgtctcttgaagagctggct
atcaagcacagcaactctaaagcgaaagcgctggcggttgcccttgataaggcgactgag
aagctgctgaacaccggtaagtcacctgagcgtaaagtgggtcagctggataaccgtggc
agccatgtatggctggcgctgtactgggctgaagcactgactgagcagactgaagataaa
gagctggctgaactgttcaagccaactctggaagcgatgactgcgaacatcgacaaaatc
atcgaagaaatcgatgcgtctcagggtcagccacaggatatcggcggttactacttccct
gacgaagacaagctgtatgcagcgatgtctccaagcaaaacgctgcaggagtccctgtct
aagtaa

DBGET integrated database retrieval system