KEGG   Alteromonas sp. RKMC-009: DS731_09555Help
Entry
DS731_09555       CDS       T05653                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
alr  Alteromonas sp. RKMC-009
Pathway
alr00030  Pentose phosphate pathway
alr00480  Glutathione metabolism
alr01100  Metabolic pathways
alr01110  Biosynthesis of secondary metabolites
alr01120  Microbial metabolism in diverse environments
alr01130  Biosynthesis of antibiotics
alr01200  Carbon metabolism
Module
alr_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
alr_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
alr_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:alr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    DS731_09555 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DS731_09555 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:alr04147]
    DS731_09555 (zwf)
Enzymes [BR:alr01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     DS731_09555 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     DS731_09555 (zwf)
Exosome [BR:alr04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   DS731_09555 (zwf)
  Exosomal proteins of colorectal cancer cells
   DS731_09555 (zwf)
  Exosomal proteins of bladder cancer cells
   DS731_09555 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AYA64216
UniProt: A0A385MUR2
Position
2160818..2162314
Genome map
AA seq 498 aa AA seqDB search
MVMDNSFEPCDFVLFGTLGDLSRRKLLPSLYQLEKAELIHPDTKIIGVARQDLSTEDYKK
EVRNNIEKFGSKQVCEDTWARLEARLQYACVDMKNTESYRVFDSVVDADRIMVCYLATPP
AIYGDICRGLHSCDIIDSSVRVVLEKPIGHDLESSKVINDQVSEYFKESQIYRIDHYLGK
ETVLNLIALRFANSIFATNWDHNSIDHVQITVAESVGIEGRWGYFDDAGQMRDMVQNHLL
QILSLIAMEPPANLNADSIRDEKLKVLKALRPINLSNINESTVRGQYTSGFVKGEEVPGY
LEEEGANTRSRTESFVAIKADIDNWRWAGVPFYLRTGKRLPTKVSEVVIYFKRQPHNLFG
DSFQNLPPNKLVIRLQPDEGVEITVMNKVPGLTSSGSMDLQKSKLDLSFSDAFGDDRIPD
AYEKLLLEVMLGNQALFVRRDEIEQAWNWVDSILEAWKQTNEPPEPYQAGTWGPVDSIGL
LARANRSWYESKTTRKKK
NT seq 1497 nt NT seq  +upstreamnt  +downstreamnt
atggtaatggataattcctttgaaccctgtgattttgtgctgtttggcacgttaggggat
ctctcacgacggaaactattgccgtccttatatcagctggaaaaagctgagctcattcac
cctgataccaaaattattggtgtagcgcgtcaggacctgagcactgaggactacaagaaa
gaagtccgtaacaacatcgaaaaatttggttccaaacaagtttgcgaagatacctgggcc
cgccttgaagcccgtctgcaatatgcttgtgtggatatgaagaatactgaaagctaccgc
gtttttgattcagtggtagatgcagaccgcattatggtgtgctatctggcgactccgccg
gctatctacggtgacatctgccgtggtctgcacagctgcgatattatcgacagctccgta
cgggtagtgctggaaaaaccaattggtcacgatctggaatcttctaaagtcattaatgac
caggtttcagaatactttaaagaatcgcaaatctaccgcattgaccactatctgggtaaa
gaaaccgttcttaacctgattgcactgcgttttgctaactccatttttgctaccaactgg
gaccacaactccattgaccacgtacagatcactgttgctgagtcggtagggattgaaggc
cgttggggctattttgatgacgctggtcaaatgcgtgacatggtgcagaaccacctgttg
caaattctcagtctgattgccatggaaccgccggcaaacctgaatgccgacagtatccgt
gatgaaaaactgaaagtactgaaagccttacgtccgattaacctgagcaatatcaatgaa
tcaacagttcgtggtcagtacacgtccggtttcgttaagggtgaagaagtacccggctat
ctggaagaagagggtgccaacacccgcagccgtactgaaagctttgttgccatcaaggcc
gatatcgacaactggcgctgggccggcgtgccgttctatttaagaactggtaagcgtttg
ccgaccaaagtgtctgaagttgtgatttacttcaaacgtcagccacacaacctgttcggt
gacagcttccagaatctgccgcctaataaactggttatccgtctgcagcctgacgaaggt
gttgaaatcaccgtaatgaataaggtaccgggtctgaccagctcaggttcaatggacctg
caaaagtcaaaactcgacctgagtttctcagatgcatttggcgatgaccgcattcctgat
gcttatgaaaagctgttacttgaagtcatgctgggcaaccaggccctgtttgttcgccgt
gatgaaattgaacaggcgtggaactgggttgattcaattcttgaagcgtggaagcaaact
aatgagccaccggagccgtatcaggctggtacgtggggaccggtagattctatcgggtta
ttagcacgcgctaaccgtagttggtatgaaagcaaaacaacacggaagaagaaataa

DBGET integrated database retrieval system