KEGG   Alteromonas sp. RKMC-009: DS731_12150Help
Entry
DS731_12150       CDS       T05653                                 

Definition
(GenBank) thiolase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
alr  Alteromonas sp. RKMC-009
Pathway
alr00071  Fatty acid degradation
alr00072  Synthesis and degradation of ketone bodies
alr00280  Valine, leucine and isoleucine degradation
alr00310  Lysine degradation
alr00362  Benzoate degradation
alr00380  Tryptophan metabolism
alr00620  Pyruvate metabolism
alr00630  Glyoxylate and dicarboxylate metabolism
alr00640  Propanoate metabolism
alr00650  Butanoate metabolism
alr00900  Terpenoid backbone biosynthesis
alr01100  Metabolic pathways
alr01110  Biosynthesis of secondary metabolites
alr01120  Microbial metabolism in diverse environments
alr01200  Carbon metabolism
alr01212  Fatty acid metabolism
alr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:alr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DS731_12150
   00630 Glyoxylate and dicarboxylate metabolism
    DS731_12150
   00640 Propanoate metabolism
    DS731_12150
   00650 Butanoate metabolism
    DS731_12150
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DS731_12150
   00072 Synthesis and degradation of ketone bodies
    DS731_12150
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DS731_12150
   00310 Lysine degradation
    DS731_12150
   00380 Tryptophan metabolism
    DS731_12150
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    DS731_12150
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    DS731_12150
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DS731_12150
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:alr04147]
    DS731_12150
Enzymes [BR:alr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     DS731_12150
Exosome [BR:alr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DS731_12150
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AYA64696
UniProt: A0A385MW68
Position
complement(2722823..2723998)
Genome map
AA seq 391 aa AA seqDB search
MSNEAVVIVAAKRTPMGGFNGSLSSVPSTELGAEAIKSICTDVDVSQIDEVIMGCVLPAG
LGQAPARQAALKAGLPLSAGAITLNKVCGSGLKAVMLAHDLIKAGSAEVVVAGGMESMSN
APYLLPKARTGYRMGHGQVLDHMMLDGLENAYDGKAMGCFAQDTADSEGLTRGQMDEYAL
TSLSRANEAINTGAFANEISAITISTRKGDVVVDTDEGPGSARPDKIPSLRPAFKKDGTV
TAANSSSISDGAAALLVMSESKAASLGLTPLAKVVAHATDAIEPENFTVAPVGAMEKVLD
KAGWSKEDVDLWEINEAFAMVTMLAIQKLGLDAEKVNINGGACALGHPIGASGARILVTL
IHALANKGAKKGIASLCIGGGEGVALAVEMC
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagcaatgaagcggtagtaattgtggcagcaaaacgtacccctatgggtggattcaat
ggcagtttgtcttctgtgccatcgacggagctgggtgctgaagcgattaagtcaatttgt
actgatgtggatgtaagtcagattgatgaagtcattatgggctgtgtattacctgccggt
ctgggtcaggcgccggccagacaagctgcattgaaagcaggcctgcctttatctgccggt
gcaattaccctcaataaagtgtgcggatccggactcaaagccgtgatgctggcccacgat
ctgatcaaagcaggcagcgcagaagtcgtcgtagcgggtggcatggaaagtatgagtaat
gcaccgtatttgttgccaaaagctcgcacaggttaccgtatgggtcatggtcaggtactt
gatcatatgatgctggacggacttgagaatgcctatgatggtaaagccatggggtgcttt
gcgcaggataccgctgacagtgaaggactgacccgtggtcagatggatgaatacgcgtta
acttcactttcccgtgcgaacgaagctatcaacaccggtgcgtttgccaatgaaatttct
gctattaccatttctacccgtaagggcgatgtggtggttgatactgacgaaggaccgggt
tcagcccgtcctgataagattccgtcattacgtcctgcattcaaaaaggacggtacggta
acagcggcaaactccagctcaatttccgatggtgctgcagccctgctggtgatgtctgaa
tcgaaagcagcgtcacttggcctgacgccactggctaaagtggtggcgcacgctaccgat
gccattgaaccggaaaacttcactgttgctcctgtaggtgcaatggaaaaagtgctcgat
aaggccgggtggtctaaagaagacgtcgatctttgggaaatcaatgaagcgtttgccatg
gtaaccatgctggccattcaaaagctgggtctggatgcagagaaggtgaatattaatggt
ggtgcctgtgcgttaggtcaccctattggtgcatccggtgctcgtattctggtgacgctt
atccacgcactggctaacaaaggagcgaagaaaggtattgcttctttatgtatcggtggt
ggcgaaggtgtagcccttgccgttgaaatgtgctga

DBGET integrated database retrieval system