KEGG   Alteromonas sp. RKMC-009: DS731_13505Help
Entry
DS731_13505       CDS       T05653                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
alr  Alteromonas sp. RKMC-009
Pathway
alr00730  Thiamine metabolism
alr00790  Folate biosynthesis
alr01100  Metabolic pathways
alr02020  Two-component system
Module
alr_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:alr00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    DS731_13505
   00790 Folate biosynthesis
    DS731_13505
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DS731_13505
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:alr04147]
    DS731_13505
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:alr00537]
    DS731_13505
Enzymes [BR:alr01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     DS731_13505
Exosome [BR:alr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DS731_13505
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:alr00537]
 Enzymes
  DS731_13505
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme Sulfatase Phosphodiest PglZ
Motif
Other DBs
NCBI-ProteinID: AYA64947
UniProt: A0A385MWM7
Position
3024251..3026155
Genome map
AA seq 634 aa AA seqDB search
MKVFKYSLLAMAMAGLTACSLDGDDGADGTDGSNGLNSLTVQSELATGDANCPNSGVRFD
SGLDADGDGALSDSEISETSYVCVPANAEVATSELLTSLNNEYFVAGQAEVEAAKTTWLN
ATGTTSVDGVQTITSNTTVIKHASVEAAVASLKGKAKNVILFVGDGMGVSTVTAARIMEG
QMNGDNGEENQLSFDRFPFAGLSKTYNVDAQTPDSAGTMTAMMSGVKTDVGVIGVNENIV
RGDCSTVAGNELVTALELAELAGKSTGIVSTARITHATPAATYAKSADRNWEDDGDMPAE
AITAGCSDIAAQLVGFEAATEAHFGADIDGIEVVMGGGRRSFLPKDAAFNSPDAVSAVEG
DRTDGRDLTAEWSAQYPNGVYLYDQAGFDGLDTETTERVFGLFNESHMQYDADRANDVAG
EPSISEMTEAAIKILDNNDDGFFLMVESGRIDHAHHAGNAYGALTDTIALADAVAVADEL
TDDEDTLIIVTADHGHVFTIAGYPKRGNPILGKVVNVGADEAATAADGMPYTTVGYMNGN
GFRDLGNETDADEIYNYDVNAGRQDLADVDTTAAGFHQESLIPLSSETHSGEDVGIYAKG
PGAFLVNSTNEQSVIFHVMDFAGSLIDDAEAAIE
NT seq 1905 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtatttaaatatagccttttagccatggccatggccggcctgaccgcttgttct
cttgacggtgacgatggcgctgacggtactgacggcagcaacggattaaacagcctgaca
gtacaatctgaactggccaccggcgatgcaaactgcccgaacagcggcgtacgttttgat
tcaggccttgatgccgacggtgacggcgcgttaagcgacagcgaaatttctgaaaccagt
tatgtgtgtgtaccagctaatgcagaagtggcgaccagtgaattactgaccagcctgaac
aacgaatatttcgtagccggtcaggcggaagttgaagcggccaaaaccacctggctgaat
gccaccggcacaacctctgtggacggcgttcagactattaccagcaataccacagtgatc
aaacacgcttctgtggaagcggctgttgcatcgctgaaaggtaaagcgaaaaacgttatc
ctgttcgtcggtgacggtatgggcgtgtctactgtgacggcagcccgtatcatggaaggc
cagatgaacggtgacaacggtgaagagaaccagttaagtttcgaccgcttccctttcgcc
ggtttatctaaaacctataacgttgatgcacaaacgccagactcagcgggtaccatgacc
gcaatgatgagcggcgtgaaaaccgatgttggcgtaattggtgtgaacgaaaatattgtt
cgcggtgactgcagcaccgttgccggtaatgagctggtaacggcgctggaactggcggaa
ctggccggtaaatctaccggtatcgtgtctactgcacgtatcactcacgctacacctgca
gcgacttacgccaaatcagctgaccgtaactgggaagacgatggcgacatgcctgcagag
gccattactgccggttgttccgatattgctgcgcaactggttggttttgaagctgccaca
gaagcacatttcggtgctgacattgacggtatcgaagttgttatggggggcggccgccgt
tcattcctgcctaaagacgctgcttttaacagccctgacgctgtcagcgctgttgaaggt
gaccgtacagacggacgggatctgaccgcagaatggtctgcgcaatatcccaatggtgtt
tacctgtacgatcaggccggttttgacggcctcgatacagaaaccactgagcgggttttc
ggcctgttcaatgagtctcacatgcaatacgacgcagaccgcgctaacgatgtagccggt
gagccgtcaatcagtgaaatgacagaagcagctattaagattctggataacaacgatgac
ggcttcttcctgatggtggaatccggtcgtattgaccatgcccaccacgccggtaacgcc
tacggtgcactgaccgatacgattgcccttgctgatgcggtagctgtagctgatgagtta
acggatgatgaagatacattaatcatcgtcacagccgaccacggccacgtatttaccatt
gccggttatccgaaacggggtaatccgattttgggtaaagtggttaacgttggcgctgat
gaagctgcaactgcggctgacggtatgccatacaccacggttggttacatgaacggtaac
ggcttccgtgacctcggcaacgaaaccgatgctgacgaaatctacaactatgatgtcaac
gccggtcgtcaggatctggcagatgttgataccactgctgccggtttccaccaggagtct
ttaatcccgctttcatctgaaactcactcaggtgaagacgttggcatttatgcaaaaggc
cctggcgcattcctcgtcaacagcactaacgagcaaagcgttatcttccatgttatggat
tttgccggaagtctgattgatgacgcagaagcggccatcgagtaa

DBGET integrated database retrieval system