KEGG   Alteromonas sp. RKMC-009: DS731_18425Help
Entry
DS731_18425       CDS       T05653                                 

Definition
(GenBank) aldehyde dehydrogenase family protein
  KO
K00128  aldehyde dehydrogenase (NAD+) [EC:1.2.1.3]
Organism
alr  Alteromonas sp. RKMC-009
Pathway
alr00010  Glycolysis / Gluconeogenesis
alr00053  Ascorbate and aldarate metabolism
alr00071  Fatty acid degradation
alr00280  Valine, leucine and isoleucine degradation
alr00310  Lysine degradation
alr00330  Arginine and proline metabolism
alr00340  Histidine metabolism
alr00380  Tryptophan metabolism
alr00410  beta-Alanine metabolism
alr00561  Glycerolipid metabolism
alr00620  Pyruvate metabolism
alr00625  Chloroalkane and chloroalkene degradation
alr00903  Limonene and pinene degradation
alr01100  Metabolic pathways
alr01110  Biosynthesis of secondary metabolites
alr01120  Microbial metabolism in diverse environments
alr01130  Biosynthesis of antibiotics
Module
alr_M00135  GABA biosynthesis, eukaryotes, putrescine => GABA
Brite
KEGG Orthology (KO) [BR:alr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    DS731_18425
   00053 Ascorbate and aldarate metabolism
    DS731_18425
   00620 Pyruvate metabolism
    DS731_18425
  09103 Lipid metabolism
   00071 Fatty acid degradation
    DS731_18425
   00561 Glycerolipid metabolism
    DS731_18425
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    DS731_18425
   00310 Lysine degradation
    DS731_18425
   00330 Arginine and proline metabolism
    DS731_18425
   00340 Histidine metabolism
    DS731_18425
   00380 Tryptophan metabolism
    DS731_18425
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    DS731_18425
  09109 Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    DS731_18425
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    DS731_18425
Enzymes [BR:alr01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.3  aldehyde dehydrogenase (NAD+)
     DS731_18425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: AYA65834
UniProt: A0A385MYK5
Position
complement(4180589..4182001)
Genome map
AA seq 470 aa AA seqDB search
MQVVTDTGNAPSQDTGHYAATFAALRSTFFANKTRDISWRKQQLLALKTMLVTHEQDIHR
ALNQDLGKCETEARTSETGFLLSDLKHTLKHIDSWADLRHVSTPLAAQPARSYLQPEPLG
VVLIIGAWNYPVQLLLAPLIAALAAGNCAIVKPSELAPASSALMASLLPQYLEEDAVAVV
EGAKDETQALLALPFDHIFYTGGEAVGKIVMSAAAKYLTPVTLELGGKSPCIVDASCRLD
VTARRIVWGKWMNCGQTCIAPDYILIEKGFAEAFLAALEREITKQYGPEPLQSKDYGHIV
NTRHYERLCQLIADLQCRIGGERDDGKRKLAPAVVLNPPADSTLMQEEIFGPVLPVIELE
NIEDSIGFIRGRAKPLALYLFSEDHGFRDKVLTQTSAGSVCVNDTMMFMTNANLPFGGVG
GSGMGRYHGQYGFDTFSHLKSVMVRASKFDVAVRYAPYSRFKLWLLKKLL
NT seq 1413 nt NT seq  +upstreamnt  +downstreamnt
atgcaagttgtaactgataccggtaacgcgccctctcaggacaccgggcattatgctgca
acgttcgcagcgctgcgaagcacctttttcgccaataaaacccgtgatatcagctggcgc
aaacagcagttgctggccctcaagaccatgcttgttacccatgagcaggacattcaccgc
gccctgaatcaggatttaggcaaatgtgaaacagaagcccgtacatcggaaaccggcttt
ttactctctgacctcaagcacacacttaaacatatcgacagctgggcagatttacgtcac
gtatctacgcccctggcggcccagccggcccgcagctatctgcaacctgagccgttaggt
gtagtgctgatcatcggggcgtggaattatcccgtgcaattgcttttagcgccgctgatt
gcggcactggcagcgggcaactgtgccattgttaaaccgtcagaacttgccccggcatca
tcagcattaatggccagcttgttgcctcagtatctggaagaagatgccgtggcggttgtt
gaaggcgctaaagatgagacacaggctttattagctctgcctttcgaccacatcttttac
accggtggcgaagcggtaggcaaaattgttatgtctgcggcagcgaaataccttacgccg
gttacgctggagcttggcgggaagagcccctgtatcgttgacgccagttgcagactggac
gtcaccgccagacggatagtgtggggtaaatggatgaactgcggccagacctgtatcgct
ccggactatatcctgattgagaaagggtttgctgaagcgtttcttgctgcccttgaacgg
gaaatcactaagcagtacgggcctgaacctttgcaaagcaaagattacggacatatcgtc
aatacccgacattacgaaagactgtgtcagctcattgcggatctgcaatgccgtattggt
ggcgaacgggacgacgggaaacgcaagctggccccggctgtggtgttaaatcctccggca
gacagtacgctgatgcaggaagaaatcttcggccccgtgttgccggtcatcgaactggag
aacatagaagacagcattggctttatccgcgggcgggcaaaacctctggcgctgtatctt
ttcagtgaagatcacggctttcgtgacaaagtacttacgcaaaccagtgctggcagcgtg
tgtgtgaacgacacgatgatgtttatgaccaatgcaaacctgccttttggcggggtcggt
ggcagtggtatggggcgctatcacggacaatatggctttgatacgttcagtcatcttaaa
tcagtgatggtaagagcctcgaagtttgatgtggctgtacgctacgccccgtattcccga
tttaaattatggctgttgaaaaaattattataa

DBGET integrated database retrieval system