KEGG   Alteromonas sp. RKMC-009: DS731_21900Help
Entry
DS731_21900       CDS       T05653                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
alr  Alteromonas sp. RKMC-009
Pathway
alr00430  Taurine and hypotaurine metabolism
alr00620  Pyruvate metabolism
alr00640  Propanoate metabolism
alr00680  Methane metabolism
alr01100  Metabolic pathways
alr01120  Microbial metabolism in diverse environments
alr01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:alr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    DS731_21900
   00640 Propanoate metabolism
    DS731_21900
  09102 Energy metabolism
   00680 Methane metabolism
    DS731_21900
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    DS731_21900
Enzymes [BR:alr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     DS731_21900
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase
Motif
Other DBs
NCBI-ProteinID: AYN07651
Position
unnamed:complement(49462..50571)
Genome map
AA seq 369 aa AA seqDB search
MDNIEQHIFETERILICNAGSGSLELQEWEESTKLNLNIVEGEPKQLFDHFKKYIDETLP
YQIILHRVVHIGKVDRNPKPVDEDCLNLIRHWSPLAPLHNEIALRLIEYGIRECPHAKHF
IFSDSTLFNTIPDCARHYALPDGLSEKWPIMRYGFHGLAHQSQWNQLQKQKKYERVITIH
LGGGSSLAAWKGGIVIDTTMGFTPSDGLPMTTRSGSIDPNIVLHLLEREEHTPESLSRLF
NHSSGLAGISGISGDYRDLKKSESGSASVALEIYSYALTKAIGAFVGVMGGVDAIVFGGG
LGEHQPDIRADSLCQLSKLGISICEKKNRSAQGICALHQKHSQTEIWLIPSDECLEMLGQ
YKRYSKETV
NT seq 1110 nt NT seq  +upstreamnt  +downstreamnt
atggacaatatagagcaacatatattcgaaacagagagaattttgatttgcaatgcgggg
agtggttcattagaacttcaagagtgggaagagtcaaccaagcttaatttgaatatagtg
gagggcgaacccaagcagctttttgatcatttcaaaaaatatatagacgagacgctacca
tatcaaataattttgcaccgtgttgtacatattggaaaggtggatcggaatcctaagcca
gtagatgaagattgccttaacttaataaggcattggtcgcccttagctccgcttcacaat
gaaattgcgcttaggttgattgaatatggaataagggaatgtccgcatgcaaaacatttt
attttctcagattctacacttttcaataccattccagattgtgcacgtcattacgcccta
cctgacggactctctgaaaaatggccaataatgagatatggatttcacgggcttgcgcat
cagtcccaatggaatcaactgcaaaagcaaaagaaatatgaacgcgttatcactatacat
ctcggaggcggaagctcattagctgcctggaaagggggaatagttatcgacacaacaatg
ggctttacaccaagtgacggccttcctatgacaacacgtagcggaagtatagatcctaat
attgtattgcatttgcttgaacgggaagaacacacacctgaaagcttatccagattattt
aaccattcttctggactcgcaggaattagcggaatttcaggagactaccgtgatctcaaa
aagagtgagtctggctctgcttctgtagcgttagaaatatattcctatgcacttaccaag
gcaataggagcttttgtcggtgtaatgggaggcgtagatgctattgtattcggaggtgga
cttggtgagcaccaaccggatatacgagcagattctttatgtcagctgagcaagcttggg
atttctatttgtgaaaaaaagaatagaagtgcacaaggaatttgcgcgcttcatcaaaaa
cattctcaaactgaaatatggcttattcccagcgatgaatgcctggagatgctcggccag
tataaacgatattccaaggagacagtttaa

DBGET integrated database retrieval system