KEGG   Arcticibacterium luteifluviistationis: DJ013_03645Help
Entry
DJ013_03645       CDS       T05496                                 

Definition
(GenBank) Co2+/Mg2+ efflux protein ApaG
  KO
K06195  ApaG protein
Organism
als  Arcticibacterium luteifluviistationis
Brite
KEGG Orthology (KO) [BR:als00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99994 Others
    DJ013_03645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF525 LIFR_N DUF4354
Motif
Other DBs
NCBI-ProteinID: AWV97311
UniProt: A0A2Z4G800
Position
complement(867129..867515)
Genome map
AA seq 128 aa AA seqDB search
MVTAVTEGIKVSVKSKYQPYYSSVRQMNFVFAYEICIENNSHHTIQLLKRHWYIIDANGY
TREVKGDGVIGVQPVIEPGQDHKYVSGCNLTTTLGKMHGTFLMERQLDGKQFEVNIPEFN
LMTPFSQN
NT seq 387 nt NT seq  +upstreamnt  +downstreamnt
atggttactgcagttacagaaggtattaaagtgagcgtaaagtcgaagtatcaaccgtac
tactctagtgtacgtcagatgaactttgtttttgcttatgaaatatgtattgaaaacaac
agtcatcacaccattcagcttcttaaaagacactggtatattatagatgccaatggttat
acaagagaggtgaaaggtgatggggttattggcgtgcagcctgtgatagagccaggccaa
gaccataagtatgtttctggctgtaatcttactactacgctagggaaaatgcacggtact
tttttaatggaaaggcaattagacggaaagcaatttgaggtaaacatacctgagtttaat
ctcatgacaccgttttctcaaaattaa

DBGET integrated database retrieval system