KEGG   Arcticibacterium luteifluviistationis: DJ013_13885Help
Entry
DJ013_13885       CDS       T05496                                 

Definition
(GenBank) alkaline phosphatase
  KO
K01077  alkaline phosphatase [EC:3.1.3.1]
Organism
als  Arcticibacterium luteifluviistationis
Pathway
als00730  Thiamine metabolism
als00790  Folate biosynthesis
als01100  Metabolic pathways
als02020  Two-component system
Module
als_M00126  Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:als00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    DJ013_13885
   00790 Folate biosynthesis
    DJ013_13885
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    DJ013_13885
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:als04147]
    DJ013_13885
   00537 Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:als00537]
    DJ013_13885
Enzymes [BR:als01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     DJ013_13885
Exosome [BR:als04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   DJ013_13885
Glycosylphosphatidylinositol (GPI)-anchored proteins [BR:als00537]
 Enzymes
  DJ013_13885
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alk_phosphatase Metalloenzyme GDPD_2 Hydrolase_6
Motif
Other DBs
NCBI-ProteinID: AWV99197
UniProt: A0A2Z4GDK5
Position
complement(3370251..3372020)
Genome map
AA seq 589 aa AA seqDB search
MNKLLVFLFLITGLSYGQNFQVHSHNDYAQDVPFWKAFSAGCASIESDLILQNGKLMVAH
NVPDIKAVNTFENLYLKPLQVIMNSEQYEAFDLQILIDFKTAAEPTLKVLMAQLEKYPEL
INGKNAAKKVSFVISGKRPEAEQYENYPSYINFDHQTVDTWPTNMDKVALVSLPFYKYTP
WNGKGRLTSGDEAKLKTVIDQIHAKGKKVRFWATPDSKTAWYTLSKLGIDFINTDEPFAC
NAYLATLSERLVPRVEKDEATFKMPAAKFQQAAVILMVGDGTGLAQISAGILSQKTPLNL
ARIKSIGLIKTEAADDFTTDSAAGGTALATGKKTNNRYIGLDAEGKELLTIFDAAEAANY
STGIVTTDGIAGATPSAFYAHAADRDSSKKIGDYLLKSQMDIFIAGGGKAFKNTKWENRK
IVSSISEIGTTSDAKVGFFAADGGLPYITEGRGNYLPKATMEALNFLEKKNKPFTLLIEN
GHIDGSGHANKAKALAAEVRDFDKAIGLVMQYVDSHPETLLIITADHETGGVTLPHGTKD
EMEVQFHSDDHTGILVPLFAYGKGAEKLQGIYDNTEVYQRMVEFINAHK
NT seq 1770 nt NT seq  +upstreamnt  +downstreamnt
atgaacaaattattagtattcctttttcttataacgggcctttcttatgggcaaaatttt
caagtgcattcgcacaatgattatgcacaagatgttcctttttggaaagctttttctgca
ggatgtgcctcaatagaatctgacttgattttgcaaaatggcaaactgatggtagctcat
aatgtgccagacataaaagcggtcaatacttttgaaaatctatatttaaagccgctccag
gtgattatgaactccgagcagtatgaggctttcgatttacaaatattgatagactttaaa
acggcggcagagcccaccttgaaggttttgatggctcagttggaaaaataccctgagctt
ataaatggcaagaatgccgcaaagaaagtgtcgtttgtgatttcaggtaagagacctgaa
gcagaacaatacgagaattacccaagttatatcaatttcgatcatcaaactgtagatact
tggccaacaaacatggacaaggtggctttagtcagtttacctttctataaatatacgcct
tggaatggaaaaggaaggttgacaagtggtgatgaagccaagcttaaaacggttattgac
cagattcacgctaaaggtaaaaaagttaggttttgggctacgcccgattctaaaacagct
tggtatacgctttcaaaactaggtatagactttataaacacagatgagccatttgcatgc
aatgcttatttggcaactctttcggaacgtttggtgcctagggtagagaaagatgaggca
acttttaaaatgcctgccgctaaatttcagcaagctgccgtgatattgatggtaggggat
ggaacagggctagcacagatttctgcaggaattttgagtcaaaaaactcctttaaactta
gcaagaataaagagcatcgggcttattaaaacagaagcagccgacgactttactacagac
tctgccgcaggaggaacagccttagccacaggaaagaaaacaaacaataggtacattgga
ctagatgcagaaggcaaagaattgctaaccatttttgatgcagcggaagcggcaaattat
agtacaggaatagtgactacagatggtattgcaggtgctacaccatcggctttttatgct
cacgcggcagatagagatagctcgaagaagataggagactatttattgaaaagtcaaatg
gatatttttatagctggcggtggcaaagcttttaaaaatactaagtgggaaaatagaaag
atagtaagcagcatatcagaaataggaactacttcagatgcgaaggttggtttttttgca
gctgatggtggtttaccttatatcacagaaggaaggggaaattacctgccaaaagcaaca
atggaagctttgaactttttggagaaaaagaataagccatttacgttattaatagaaaat
ggacatatagatggttcgggtcatgctaacaaggccaaagctttggcagctgaggttaga
gattttgataaagcaattggtttagtgatgcagtatgtagacagtcatccggagacttta
ttaatcattacggctgaccatgaaacaggtggtgtaactttacctcatggcactaaagat
gagatggaagtgcagtttcattcagatgaccatacaggaatcttggttcctctttttgcc
tatggaaagggagctgaaaagctacaaggtatttatgacaacacggaagtttatcagaga
atggtagagtttataaacgctcataaatag

DBGET integrated database retrieval system