KEGG   Arcticibacterium luteifluviistationis: DJ013_18895Help
Entry
DJ013_18895       CDS       T05496                                 

Definition
(GenBank) glutathione peroxidase
  KO
K00432  glutathione peroxidase [EC:1.11.1.9]
Organism
als  Arcticibacterium luteifluviistationis
Pathway
als00480  Glutathione metabolism
als00590  Arachidonic acid metabolism
als01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:als00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    DJ013_18895
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    DJ013_18895
Enzymes [BR:als01000]
 1. Oxidoreductases
  1.11  Acting on a peroxide as acceptor
   1.11.1  Peroxidases
    1.11.1.9  glutathione peroxidase
     DJ013_18895
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GSHPx Redoxin AhpC-TSA
Motif
Other DBs
NCBI-ProteinID: AWW00973
UniProt: A0A2Z4GHP3
Position
complement(4622214..4622765)
Genome map
AA seq 183 aa AA seqDB search
MNFTTIKNLLSNKKEVATLPENMEVLGSFYDFKMKSLTGQEIDLSQYKGKKVVVMNVASK
CGYTPQYADWQKFHEEHGKDIIVLGFPANNFGAQESGSNDEIASFCQLNYGVEFQMFEKV
DVIGENQHPLFQWLSKKDLNGWNDKAPTWNFCKYVINEKGKVTNFFASKIKPEDAEFKAA
VGL
NT seq 552 nt NT seq  +upstreamnt  +downstreamnt
atgaacttcaccactatcaaaaacttattatccaacaaaaaagaagtggctaccctacca
gaaaatatggaagttttaggctctttttatgactttaaaatgaagtcactgactggtcaa
gagattgatttgtcacaatacaaaggaaaaaaagtagtggtcatgaatgttgcctctaaa
tgcggctacactcctcaatatgccgactggcaaaaattccatgaagaacatggtaaagac
attatagtgctgggttttcctgccaataattttggagcacaagagtctggttcaaatgac
gaaattgcttccttttgtcaattaaactacggagtagaatttcaaatgtttgaaaaggta
gatgtgattggcgaaaaccaacacccactttttcaatggttaagcaaaaaggacttaaac
ggctggaacgacaaagccccaacttggaacttctgtaaatatgttatcaacgaaaagggt
aaagtaacaaacttctttgcctctaagataaaaccagaagacgcagaatttaaagctgct
gttggactttaa

DBGET integrated database retrieval system