KEGG   Alteromonas naphthalenivorans: ambt_00275Help
Entry
ambt_00275        CDS       T01513                                 

Definition
(GenBank) acetyl-coenzyme A synthetase
  KO
K01895  acetyl-CoA synthetase [EC:6.2.1.1]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00010  Glycolysis / Gluconeogenesis
alt00620  Pyruvate metabolism
alt00640  Propanoate metabolism
alt00680  Methane metabolism
alt01100  Metabolic pathways
alt01110  Biosynthesis of secondary metabolites
alt01120  Microbial metabolism in diverse environments
alt01130  Biosynthesis of antibiotics
alt01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ambt_00275
   00620 Pyruvate metabolism
    ambt_00275
   00640 Propanoate metabolism
    ambt_00275
  Energy metabolism
   00680 Methane metabolism
    ambt_00275
Enzymes [BR:alt01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     ambt_00275
Lipid biosynthesis proteins [BR:alt01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   ambt_00275
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AMP-binding AMP-binding_C ACAS_N
Motif
Other DBs
NCBI-ProteinID: AEF01617
UniProt: F5ZA03
Position
69275..71224
Genome map
AA seq 649 aa AA seqDB search
MTASKIFSVPDAIKSNTHLTDAQYAEMYANSVAHPEAFWAEHANLLEWFKKPTKVKNTHF
GDNDVSIKWFEDGELNASYNCIDRHLADSADKVAIHWEGDSPEDSQDITFQEVHDEVCKL
ANALKSLGVTKGDRVAIYMPMVPDAAYAMLACARIGAIHSVIFGGFSPNAIADRINDSDA
KVVITADEGRRAGRSVPLKANVDKALSKGACPSITHVIVKKVTGEDVAWNESHDVWWDEL
VAECATTCEPEVMNAEDPLFILYTSGSTGTPKGVVHTTGGYLLYTAMTFKYAFDYQENDV
YWCTADVGWITGHSYMVYGPMINGASQVFFEGVPTYPDVRRIAQVVEKYKVNSLYTAPTA
IRALMAHGDKPAEGCDLSSLRLLGTVGEPINPEAWEWYYRVIGQSRCPIMDTWWQTETGG
HMITPLPGATALKPGSATRPFFGIQPALFDAEGNELEGAAEGNLVIKDSWPSQARTVYGD
HQRFISTYFSAYKGVYFTGDGARRDEDGYYWITGRVDDVLNVSGHRLGTAEIESALVAHP
KVAEAAVVGFPHDIKGQGIYVYVTPIDGVAVDDALTTELKNWVRQELSPIATPDKIQWSA
GLPKTRSGKIMRRILRKIAANEHEQLGDISTLADPSVVDTLIEERLNKS
NT seq 1950 nt NT seq  +upstreamnt  +downstreamnt
atgactgccagtaagattttttctgttcctgacgcgattaaaagtaacacccatttaacg
gatgctcagtacgctgagatgtatgctaattctgtagcacaccctgaagcattttgggct
gaacatgcaaacttacttgaatggtttaaaaagccgaccaaagtgaaaaacacccatttt
ggtgacaatgatgtttctattaaatggtttgaagacggtgaattaaatgccagttacaac
tgtatcgaccgtcacctagcagacagcgctgataaagtggctattcactgggaaggtgac
tcccctgaagacagccaagatattacttttcaagaagtgcacgatgaagtttgtaaatta
gctaacgctcttaaatctctaggtgtgactaaaggcgacagagtcgctatttatatgcca
atggtgcccgacgctgcttacgctatgttggcgtgcgcccgaattggtgctattcactct
gttatttttggggggttctcgccgaacgcgattgccgatcgtattaatgatagcgatgcc
aaagtggttattacggcagatgaaggccgccgagcgggtcgctctgtacctctaaaagcc
aatgtagataaggccttgtcaaaaggtgcttgcccatccattactcatgtcatcgttaag
aaagtaacaggtgaagatgtagcgtggaacgaaagtcacgatgtatggtgggatgagctg
gtggctgagtgcgccacaacgtgtgagcctgaagtgatgaacgcggaagacccactgttt
atcctgtatacatcgggttcaactggcacgcctaaaggcgtagtgcatactaccggtggt
tacttgctttataccgccatgacctttaaatacgcctttgattatcaagaaaatgatgtt
tactggtgtactgcggatgtcggttggatcacaggacacagctacatggtctacggccct
atgatcaacggcgcttctcaggtgttttttgagggcgtacctacttatcctgacgtgcgt
cgtattgcgcaagtagtagaaaaatacaaagtaaacagcctttacacggcaccaacggct
attcgtgcattgatggcgcatggtgataagccagcagaaggttgcgacttatcttcgtta
cgtttactcggtacagttggtgaaccaattaaccctgaagcgtgggaatggtattaccgt
gtaattggccaaagccgttgtcctatcatggatacatggtggcagactgaaactggtggc
catatgataacgccattacctggtgccacagcacttaagcctggttctgccacgaggcca
ttctttggtattcagcctgcgcttttcgatgctgaaggcaacgaacttgaaggcgcagcc
gaaggtaaccttgtgattaaggatagctggccaagccaagctagaactgtatatggcgac
catcaacgctttatcagtacctactttagtgcttacaaaggtgtatactttaccggtgat
ggcgcaagacgtgatgaagatggttattactggattacagggcgcgtcgatgatgtgtta
aatgtatccggtcaccgtttaggtactgctgaaattgagagcgcactagtggcgcatcca
aaagtggctgaagcggctgtagtgggcttccctcatgatattaaagggcagggcatttac
gtctacgttactccaattgacggtgttgccgttgatgatgcgctaaccacagagcttaaa
aactgggtgagacaagagcttagccccattgcgacacctgataaaatacagtggtcggct
ggcttacctaaaacccgttcaggtaaaattatgcgtcgtattttgcgtaaaattgctgcg
aacgaacatgagcaacttggtgatatatctacattggcggatccgtcagttgttgataca
ctcattgaggagcgattaaataaatcataa

DBGET integrated database retrieval system