KEGG   Alteromonas naphthalenivorans: ambt_01720Help
Entry
ambt_01720        CDS       T01513                                 

Definition
(GenBank) aconitate hydratase
  KO
K20455  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming) [EC:4.2.1.117]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00640  Propanoate metabolism
alt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    ambt_01720
Enzymes [BR:alt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.117  2-methylcitrate dehydratase (2-methyl-trans-aconitate forming)
     ambt_01720
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aconitase Aconitase_C
Motif
Other DBs
NCBI-ProteinID: AEF01898
UniProt: F5ZAC8
Position
complement(410589..413186)
Genome map
AA seq 865 aa AA seqDB search
MNYEYRKPLPGAGIDFFDTREAVEAIEHGAYDKLPYTSRVFAENLVRRCNPDALTDSLKQ
FIYRKNDLDFPWFPARVVCHDILGQTALVDLAGLRDAIAAKGGDPAKVNPVVPTQLIVDH
SLAVEHAGFEPDAFEKNRAIEDRRNDDRFHFIDWTKLAFKNVDVIPPGNGIMHQINLERM
SPVIQSRDGVAFPDTLVGTDSHTPHVDALGVIAIGVGGLEAESVMLGRASYMRLPDIVGV
ELTGKPQPNITATDIVLALTEFLRKERVVSSYLEFYGEGTTHLTLGDRATISNMTPEYGA
TAAMFYIDQQTIDYLRLTGREEKQIALVEQYAKHTGLWADSLASAEYERVLTFDLSSVGR
NMAGPSNPHARLATSDLAQRGVASAWEQEEGKMPDGAVIIAAITSCTNTSNPRNVIAAGL
IARNANQRGLTRKPWVKSSLAPGSKAVKLYLEEADLMGELEQLGFGVVAFACTTCNGMSG
ALDPKIQQEIIDRDLYATAVLSGNRNFDGRIHPYAKQAFLASPPLVVAYAIAGTVRFDIE
KDVLGIDNDGNPVTLKDIWPSDEEIDAIVAKSVKPEHFRKVYEPMFDLKVNTGSDISPLY
DWREMSTYIRRPPYWEGAMDAERTMTGMRPLAILGDNITTDHLSPSNAIMATSAAGEYLA
KMGLPEEDFNSYATHRGDHLTALRATLANPKVFNEMVLENGEVKQGSLARIEPEGKVVRM
WEAIEAYMQRRQPLIIVAGADYGQGSSRDWAAKGVRLAGVEVIAAEGFERIHRTNLLGMG
VLPLEFKPGTTRKTLELDGTETYDVKGEPAPGATLTLVVNRANGETLDVPVTCRLDTAEE
VSIYSAGGVLQRFAKDFLEAEEVEG
NT seq 2598 nt NT seq  +upstreamnt  +downstreamnt
atgaactacgaataccgtaaacctttgcctggcgcaggtatcgatttctttgatacccgc
gaggcagtggaagccattgaacatggtgcctacgataaacttccctacacctcacgggtg
tttgctgaaaacttagtgcgccgttgtaaccctgacgcattaaccgattcacttaagcag
tttatttatcgcaagaacgacttggattttccgtggtttccagcccgcgtggtttgccac
gacattctggggcaaaccgcgttggttgacttggctggcttacgggatgccattgcggcg
aaaggcggcgatccggcgaaagtaaaccccgttgtgcctacccagttaattgtcgatcac
tcattagccgttgaacatgcgggttttgaacccgacgcgtttgaaaaaaaccgcgctatt
gaagatagacgtaacgacgaccgattccattttatcgactggactaagttagcgtttaaa
aacgtggatgtgataccgccgggtaatggcattatgcaccaaatcaacttagagcgtatg
tcgccagttattcagtctcgcgacggcgtcgcttttccagataccttggtcggcaccgac
agccacactcctcatgttgatgcactaggcgttattgctattggtgtaggcggccttgaa
gcagaaagcgttatgctggggcgcgcctcttacatgcgcctacctgatattgtaggtgtt
gaacttaccggtaagccacagcccaatattactgctaccgatattgtattggcacttacc
gagtttttacgtaaagagcgtgtggtgtcttcttatttggaattttatggcgaaggtact
acgcaccttacccttggcgatcgcgctactatttcaaacatgacacccgaatacggcgcc
accgcggcgatgttctacatcgaccagcaaaccatcgattatttgcgcttaactggccgt
gaagaaaagcaaattgccttagttgaacaatacgcgaagcacaccggtttatgggcagat
tcattagcgagtgccgaatacgagcgtgttctcacttttgatttatcctctgttggccgc
aacatggctggcccatctaatccacatgctcgtttagccaccagcgacttggctcagcgc
ggcgttgccagcgcatgggaacaagaagaaggaaaaatgcctgatggtgcggtaattatc
gctgccattaccagttgtactaatacgtctaacccgcgcaatgtgattgcagcaggctta
attgcccgcaatgcaaaccagcgtggcttaacccgtaaaccttgggtgaaaagttcgtta
gcgccaggttctaaagcggtaaaactgtatttagaagaagccgatttgatgggcgaattg
gaacagttgggctttggtgtagtggcctttgcctgcaccacctgtaacggaatgagcggc
gcgctagacccgaaaattcagcaagaaattatagaccgtgacttatacgccacggcagtg
ctttctggtaaccgtaatttcgatggccgtattcacccgtatgcgaaacaagcctttttg
gcatcaccgccattagtggttgcctacgccattgcaggtacggttcgtttcgatattgaa
aaagacgtactaggcatagataacgacggtaaccctgtcacgctcaaagatatttggcca
agcgatgaagagattgatgccattgtcgcgaaaagcgtgaagccagagcattttcgtaaa
gtgtacgagcccatgttcgatttaaaagtgaatactggcagcgacattagcccgctgtat
gattggcgtgaaatgagtacctatattcgccgcccgccttattgggaaggtgcgatggat
gctgagcgcaccatgacgggtatgcgaccgctggctatattgggcgataacattaccacc
gatcatttatcgccatcgaatgcgattatggctaccagtgcagctggtgagtatttggcg
aaaatggggttaccggaagaagactttaactcttatgccacccataggggcgaccattta
actgcgcttcgcgctactttggcgaacccgaaagtgttcaacgagatggtgcttgaaaac
ggcgaagtgaaacagggctcgcttgctcgcatcgagccagaaggcaaagtggtgcgcatg
tgggaagccattgaagcctacatgcagcgcagacagcccctgattattgtagctggtgcc
gactatggtcagggctcttcacgcgactgggctgccaaaggtgttcgtttagctggggta
gaagtcattgccgcagagggcttcgagcgtattcaccgtaccaacttacttggcatgggt
gtattacctcttgagtttaagccaggtacaacacgcaaaacccttgaacttgatggcact
gaaacctacgacgttaaaggtgaacctgcaccgggtgctacgctaaccttagtggttaat
cgagccaacggtgaaaccctagatgtgcccgtaacctgtcgcttagataccgcagaagag
gtgtcgatttacagcgcaggcggtgtgcttcaacgctttgccaaagacttcttagaagct
gaagaggttgagggctaa

DBGET integrated database retrieval system