KEGG   Alteromonas naphthalenivorans: ambt_03095Help
Entry
ambt_03095        CDS       T01513                                 

Definition
(GenBank) nitroreductase
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00633  Nitrotoluene degradation
alt01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:alt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    ambt_03095
Enzymes [BR:alt01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     ambt_03095
  1.-  
   1.-.-  
    1.-.-.-  
     ambt_03095
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AEF02173
UniProt: F5ZAP3
Position
718441..719097
Genome map
AA seq 218 aa AA seqDB search
MSNQIISDLNQRYTVKKYDSSKRISSEDLTTILEALRLSASSINSQPWKFVVVESDSAKQ
RLHDTFANKHQFNQLHAKEASHTILFAYDPKFTKEKFVKRVDAEVASGHLPEAMRDSFMG
AYAFAEANTDENGYNGAWTKAQVYLAFGNLLHTLARLGIASTPMEGVDADLIGELFSEEL
DGHVCEVALALGYADEEQDWNHGLPKARLPMEDVITVV
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atgtctaaccaaattatcagtgatttaaaccagcgttataccgttaaaaagtacgacagt
agcaaacgtatttcttcagaagacttaaccactatattggaagcattaaggttatcagcc
tcttctataaactctcaaccttggaagtttgttgtggttgaaagtgacagtgcaaaacag
cgcctacacgacacttttgctaacaagcaccagttcaaccaattgcatgcaaaagaagca
tctcacacaatcttatttgcttacgaccctaagtttaccaaagagaaatttgttaaacgt
gttgatgctgaagtggcgtctggtcacttaccagaagcaatgcgagactcgtttatgggg
gcttacgcttttgcagaagctaatactgatgagaacggctacaacggcgcatggacaaaa
gctcaagtttatctagcatttggaaacttgctccacactctagcccgccttggtattgct
tctacaccgatggaaggcgtggacgctgacttgattggtgaattgtttagcgaagagtta
gacggacatgtttgtgaagtggcgcttgcacttggctatgcagacgaagagcaggactgg
aaccacggtttacctaaagcacgtttgccaatggaagatgtgattaccgttgtatag

DBGET integrated database retrieval system