KEGG   Alteromonas naphthalenivorans: ambt_03365Help
Entry
ambt_03365        CDS       T01513                                 

Definition
(GenBank) Enoyl-CoA hydratase/carnithine racemase
  KO
K01692  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00071  Fatty acid degradation
alt00280  Valine, leucine and isoleucine degradation
alt00281  Geraniol degradation
alt00310  Lysine degradation
alt00360  Phenylalanine metabolism
alt00362  Benzoate degradation
alt00380  Tryptophan metabolism
alt00410  beta-Alanine metabolism
alt00627  Aminobenzoate degradation
alt00640  Propanoate metabolism
alt00650  Butanoate metabolism
alt00903  Limonene and pinene degradation
alt00930  Caprolactam degradation
alt01100  Metabolic pathways
alt01110  Biosynthesis of secondary metabolites
alt01120  Microbial metabolism in diverse environments
alt01130  Biosynthesis of antibiotics
alt01212  Fatty acid metabolism
Module
alt_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    ambt_03365
   00650 Butanoate metabolism
    ambt_03365
  Lipid metabolism
   00071 Fatty acid degradation
    ambt_03365
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ambt_03365
   00310 Lysine degradation
    ambt_03365
   00360 Phenylalanine metabolism
    ambt_03365
   00380 Tryptophan metabolism
    ambt_03365
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    ambt_03365
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    ambt_03365
   00281 Geraniol degradation
    ambt_03365
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ambt_03365
   00627 Aminobenzoate degradation
    ambt_03365
   00930 Caprolactam degradation
    ambt_03365
Enzymes [BR:alt01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     ambt_03365
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ECH_1 ECH_2
Motif
Other DBs
NCBI-ProteinID: AEF02225
UniProt: F5ZBY7
Position
complement(779186..779842)
Genome map
AA seq 218 aa AA seqDB search
MAFELKIENKVALITFDDGKVNAVGFSLIDALNNALDEAEQNADAVVMYGGADKFCGGFD
LSVMKAEDKTEQVKLVQAGADLIIRLYSYPKPLVVAAEGHSIALGAIFLMAADLRIGKDG
DTKYGLTETAIGMVLPAFGMELAKSRLAPTSLTEALLFSRVYQGKDAVKVGYLDAAVPQE
QVLATAMGYAEKLKMLPAKAFAESKLQLRKETLSKMRG
NT seq 657 nt NT seq  +upstreamnt  +downstreamnt
atggctttcgaattaaaaattgaaaacaaggtagcactgattacctttgatgacggcaag
gtaaacgcagtaggcttttctcttattgacgcattgaataacgcactagatgaagctgag
caaaacgctgatgccgtagtgatgtatggcggtgccgataagttttgcggcggattcgac
ctttcagtgatgaaagccgaagacaaaaccgagcaagtaaaattagtgcaagcaggcgcc
gatttaattataagactgtacagctaccctaaaccccttgttgttgctgctgaaggacat
agtattgcgttaggcgcaatattcttgatggccgctgacttacgtattggtaaagatggc
gacaccaaatatggcttaaccgagaccgctattggtatggtattgcctgcgtttgggatg
gaattggcgaaatcacgtttagcccctacttcattaacagaagcgttactcttttcgcga
gtataccaagggaaggatgcggtaaaagtgggctatttagatgctgcagtgccgcaagag
caagtactcgctaccgctatgggctatgctgaaaagcttaaaatgttgcctgcaaaagcg
tttgctgaatctaagctacaacttcgcaaagaaaccctatctaaaatgcgcggctag

DBGET integrated database retrieval system