KEGG   Alteromonas naphthalenivorans: ambt_05840Help
Entry
ambt_05840        CDS       T01513                                 

Definition
(GenBank) aldose 1-epimerase-like protein
  KO
K01792  glucose-6-phosphate 1-epimerase [EC:5.1.3.15]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00010  Glycolysis / Gluconeogenesis
alt01100  Metabolic pathways
alt01110  Biosynthesis of secondary metabolites
alt01120  Microbial metabolism in diverse environments
alt01130  Biosynthesis of antibiotics
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ambt_05840
Enzymes [BR:alt01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.3  Acting on carbohydrates and derivatives
    5.1.3.15  glucose-6-phosphate 1-epimerase
     ambt_05840
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldose_epim
Motif
Other DBs
NCBI-ProteinID: AEF02705
UniProt: F5ZBB2
Position
complement(1340014..1340868)
Genome map
AA seq 284 aa AA seqDB search
MSTESLQVSESNGLTFLEVDNHLGSAKISLFGGHVLSFIPKKDGQERLWVSPHAYLNGER
PIRGGIPVCWPWFSDDHGKAKGELPAHGFLRTQVWQLTSSSEDETGTHITLAPSFTRAEG
FEHDCAVTLSITVGNALTVSLITENTGVVPFIYNCALHSYFHVDHIQAVRLEGVTGDYKD
KLDDWAVKPTPENYTFTGETDRIHMSPVEKASIVVNDKPFTDVGSKGHDSLVVWNPWQSA
ASISDMDPFGYKHMLCVESSITQGKTLQPSESHAMVQTITPVLR
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
atgtcaacagaatcattgcaagtaagcgaatcaaacggattgacgtttttagaggtagat
aaccacctcggttcagcaaaaatcagtttatttggcggacatgtcttatcttttattcca
aaaaaagatggccaagaacgcttatgggtaagcccccatgcctaccttaacggtgaacgc
cccattcgtggtggaatacctgtatgttggccatggtttagtgatgaccatggtaaagcg
aaaggtgagctgcctgcccatggttttttgcgtacacaagtgtggcaattaacttcatca
agtgaagatgaaactggcacccatattacgctcgccccctccttcactcgtgcggaaggg
tttgaacatgactgtgcggttaccctatcgattactgtaggtaacgctcttactgtatcg
ctaataactgaaaatacaggcgtagtgccatttatttacaactgcgcgttacacagttac
ttccatgttgatcatattcaagcggttcgccttgaaggtgtaaccggtgactataaagat
aagctcgatgactgggcggtaaagcccacaccggaaaattatacttttaccggtgaaact
gaccgtattcatatgagcccggtagaaaaagcgtctattgtggtaaacgataaaccattt
actgatgttggttcaaaaggccacgactcattggtggtctggaacccatggcagagtgct
gcttcaatttctgatatggatccgttcgggtacaaacatatgctttgtgtagagtcgtct
atcacccaaggcaagacactacagccaagtgagtctcacgccatggtgcaaacgataacg
cctgtgttgcgctag

DBGET integrated database retrieval system