KEGG   Alteromonas naphthalenivorans: ambt_10270Help
Entry
ambt_10270        CDS       T01513                                 

Definition
(GenBank) acetyl-CoA acetyltransferase with thiolase domain
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00071  Fatty acid degradation
alt00072  Synthesis and degradation of ketone bodies
alt00280  Valine, leucine and isoleucine degradation
alt00310  Lysine degradation
alt00362  Benzoate degradation
alt00380  Tryptophan metabolism
alt00620  Pyruvate metabolism
alt00630  Glyoxylate and dicarboxylate metabolism
alt00640  Propanoate metabolism
alt00650  Butanoate metabolism
alt00900  Terpenoid backbone biosynthesis
alt01100  Metabolic pathways
alt01110  Biosynthesis of secondary metabolites
alt01120  Microbial metabolism in diverse environments
alt01130  Biosynthesis of antibiotics
alt01200  Carbon metabolism
alt01212  Fatty acid metabolism
alt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:alt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    ambt_10270
   00630 Glyoxylate and dicarboxylate metabolism
    ambt_10270
   00640 Propanoate metabolism
    ambt_10270
   00650 Butanoate metabolism
    ambt_10270
  09103 Lipid metabolism
   00071 Fatty acid degradation
    ambt_10270
   00072 Synthesis and degradation of ketone bodies
    ambt_10270
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    ambt_10270
   00310 Lysine degradation
    ambt_10270
   00380 Tryptophan metabolism
    ambt_10270
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    ambt_10270
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    ambt_10270
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    ambt_10270
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:alt04147]
    ambt_10270
Enzymes [BR:alt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     ambt_10270
Exosome [BR:alt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ambt_10270
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt ACP_syn_III_C ACP_syn_III DUF5417
Motif
Other DBs
NCBI-ProteinID: AEF03578
UniProt: F5Z935
Position
complement(2297318..2298493)
Genome map
AA seq 391 aa AA seqDB search
MSSETVVIVAAKRTPMGGFNGSLSGVAATELGATAIKSVCDTFDVSHVDEVIMGCVLPAG
LGQAPARQASLGAGLSLSAGVTTINKVCGSGLKAVMLAHDLIKAGSAEVVVAGGFESMSN
APYMLPKARTGYRMGHGQVLDHMMLDGLENAYDGKAMGCFAQDTADAENITRTQMDEFAL
SSLSKANEAINSGSFKDEIVNVTISGRKGDVVVDTDEGPGSARPEKIPSLRPAFKKDGTV
TAANSSSISDGAAALLVMSESKAHALGLAPLAKVVAHATHSIEPENFTVAPVGAMENVLS
KAGWSKDEVDLFEINEAFAMVTMLAVQKLGLDERKVNIKGGACALGHPIGASGARILVTL
LHALNQKNAKKGIASLCIGGGEGVALAVEML
NT seq 1176 nt NT seq  +upstreamnt  +downstreamnt
atgagtagtgaaacagtagtgatcgtagcagcgaagcgcacaccaatggggggcttcaat
ggaagtctgtctggggtagccgccaccgaactaggtgccactgccattaagtcggtgtgc
gatacattcgatgtaagccacgttgatgaagttattatggggtgcgttctacctgctggc
ttaggtcaagcgcccgctcgtcaggcatcgttaggcgcaggcctttctcttagcgcaggc
gtaaccaccattaacaaagtgtgtggttctggtttaaaagcggtaatgctggctcacgat
ttaatcaaggccggtagcgctgaagtggttgtagctggtgggttcgaaagtatgagcaat
gcgccgtatatgttgccaaaggcaagaacaggctatcgcatggggcacggacaagtactc
gaccatatgatgttagatggtcttgaaaatgcttacgatggaaaggcgatgggatgtttt
gcgcaagatactgcggatgctgaaaacattacgcgaactcaaatggatgaattcgcgctt
agttcgctttcaaaagccaatgaagctattaacagcggtagtttcaaagatgaaatcgtg
aatgtgactatctcaggccgcaaaggcgatgtagtggttgatactgacgaaggcccgggt
tcagcacgaccagaaaagatcccatcccttcgccctgcatttaaaaaggatggcacggta
accgcagcaaattccagctctatttcagatggtgcggcggcgttactcgtgatgagtgag
tctaaagcacacgcgctgggattagccccacttgctaaagtggtagcccatgccacacat
tctatagagccagaaaatttcacagtagcgcctgttggagcaatggaaaatgtgctttct
aaagcaggctggtctaaagatgaagtcgacttgttcgaaattaatgaagcctttgccatg
gttactatgttggcagttcaaaagctgggattagacgagcgaaaagtgaatataaaaggc
ggcgcatgtgcgcttggtcatccgattggcgcatcgggtgcacgaattttggttaccttg
ctgcacgcgctaaatcaaaagaatgcgaaaaaaggcattgcctctttatgtattggaggt
ggggaaggcgtagcactagcggttgaaatgctataa

DBGET integrated database retrieval system