KEGG   Alteromonas naphthalenivorans: ambt_11030Help
Entry
ambt_11030        CDS       T01513                                 

Definition
(GenBank) succinyl-diaminopimelate desuccinylase
  KO
K01439  succinyl-diaminopimelate desuccinylase [EC:3.5.1.18]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00300  Lysine biosynthesis
alt01100  Metabolic pathways
alt01120  Microbial metabolism in diverse environments
alt01230  Biosynthesis of amino acids
Module
alt_M00016  Lysine biosynthesis, succinyl-DAP pathway, aspartate => lysine
Brite
KEGG Orthology (KO) [BR:alt00001]
 Metabolism
  Amino acid metabolism
   00300 Lysine biosynthesis
    ambt_11030
Enzymes [BR:alt01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.18  succinyl-diaminopimelate desuccinylase
     ambt_11030
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Peptidase_M20 M20_dimer Polysacc_deac_1 Peptidase_M18
Motif
Other DBs
NCBI-ProteinID: AEF03728
UniProt: F5ZCW6
Position
2464481..2465614
Genome map
AA seq 377 aa AA seqDB search
MLNDNVIDIAKNLMNRRSVTPEDEGCQEAMKDFLGTLGFNNETMVFDDTTNLWSRRGTEG
PVFCFAGHTDVVPSGPESAWKTPPFTATEVDGYLHGRGAADMKGSLAAMLVATRKFVADY
PDHKGSIAYLITSDEEGPFINGTTRVIDTLEARNEKITWCVVGEPSSTDEVGDIVKNGRR
GSLTGDLTVKGIQGHVAYPHLAKNPVHCATPALTELAQSHWDNGNEFFPPTSFQISNING
GTGAGNVIPGELHVCFNFRFSTEVTDQELIKRVTTILDKHELDYDIKWTFNGQPFLTDSG
PLLTATEKAIADVRGTPTILSTAGGTSDGRFIAPTGAQVIELGPVNATIHKIDECVKMSD
LELLSDMYYGILVNLLA
NT seq 1134 nt NT seq  +upstreamnt  +downstreamnt
ttgttaaacgataacgtaatagacattgctaaaaacctaatgaataggcgttcggttacc
ccggaagatgagggctgccaagaagccatgaaagattttttaggtaccttggggttcaac
aatgaaaccatggtgtttgacgataccaccaacctgtggtcacgtcgtggcacagaaggt
cctgttttttgttttgctggtcacaccgatgtggttcctagtgggcctgaaagcgcatgg
aaaaccccgccttttacggctactgaagtagacggctatttacatggccgtggtgctgcc
gacatgaaaggcagtttggccgcaatgttagtcgcaacccgtaaatttgtggccgattat
cctgatcacaaaggcagtattgcgtatcttattaccagtgacgaagaaggcccgtttatt
aatggtactactcgtgttatcgatacccttgaagcacgaaatgaaaaaatcacgtggtgt
gtggttggcgaaccatcttcgaccgatgaagtgggcgatattgttaaaaatggccgacgt
ggttcattaactggcgatcttactgttaaaggtattcaaggccatgttgcttatccgcat
ttagcgaaaaatccagtacattgcgccacacctgccttaacggaattggctcagtctcat
tgggacaatggcaacgagtttttcccgcccaccagctttcaaatttcaaacattaatggc
ggcactggtgcaggtaatgtaattcctggcgagcttcatgtgtgctttaacttccggttt
tcaaccgaagtgacagatcaagaactcattaagcgcgttacgaccattctggataagcac
gaacttgactacgacataaagtggacgtttaacggccagccttttttgacagactcaggc
ccgctgcttactgccactgaaaaagcaattgccgatgtacgtggcacgcctaccatttta
tctaccgctggcggcacatctgatgggcgatttattgcgccgactggcgcacaagttatt
gagctagggccagtaaatgccaccattcataaaatagatgaatgtgtaaaaatgagtgat
ttagagttattaagcgacatgtactacggtattttggtaaatctactcgcatga

DBGET integrated database retrieval system