KEGG   Alteromonas naphthalenivorans: ambt_11830Help
Entry
ambt_11830        CDS       T01513                                 

Definition
(GenBank) 8-amino-7-oxononanoate synthase
  KO
K00652  8-amino-7-oxononanoate synthase [EC:2.3.1.47]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00780  Biotin metabolism
alt01100  Metabolic pathways
Module
alt_M00123  Biotin biosynthesis, pimeloyl-ACP/CoA => biotin
Brite
KEGG Orthology (KO) [BR:alt00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    ambt_11830
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:alt01007]
    ambt_11830
Enzymes [BR:alt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.47  8-amino-7-oxononanoate synthase
     ambt_11830
Amino acid related enzymes [BR:alt01007]
 Aminotransferase (transaminase)
  Class II
   ambt_11830
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_1_2 Beta_elim_lyase
Motif
Other DBs
NCBI-ProteinID: AEF03886
UniProt: F5ZDC4
Position
complement(2647802..2649175)
Genome map
AA seq 457 aa AA seqDB search
MAFDWLEARLSERAQRGYLRKRVCQQYEKDNIICIDGEHYLNFASNDYLGMRQHEGVLQS
WVEGLAQFGGGSGASPLVTGHTQAHLALEAYIADGLNRDAALLFNSGFAANQALCMALFS
GAHNQSASNKSASNQTPSAAAGIKHSGEIFADRLMHASFLEGAMATKAKLRRFRHNDLAH
LSNLLEKVDTTSNSDKLVVTEGVFSMDGDSAPLRDMAGIAKQNKAWLMVDDAHGMGVLGE
NGLGSVEAQALSQTDVPIVMGTFGKAVGTAGAFIAGSQALIDYLVNFAKHYVYSTAMPPA
QAVATLYSLTHIAADSSRTDALNHNIAYFRERFSTQIGSARCSNDDSEDENGHILKASSN
NASSIKASSIKASSNTHHDLVLANSHSAIQPIIVGSPERALALSDGLKSRGIWIPAIRYP
TVPKGEDRLRITLSATHTQQDIDVLVDAIALAMESIS
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atggccttcgattggcttgaagcccgcttaagtgagcgggctcagcgaggttacctgcgc
aagcgggtatgccagcaatacgaaaaagacaacattatctgtattgatggtgagcactat
ttaaattttgccagtaacgattaccttggcatgcggcaacacgaaggcgtgttgcaaagc
tgggtagaaggcttggcacaatttggtggtggcagcggtgcttcgcccctggtaacgggc
catacccaagcacatttggctcttgaggcgtacattgccgacggtttaaatcgagacgct
gcgttgttgtttaattcgggttttgcggctaaccaagcattatgtatggcgctatttagt
ggtgctcataatcaaagcgctagtaataaaagtgctagtaatcaaaccccaagtgccgca
gccggcattaaacattccggtgaaatttttgccgatcggcttatgcatgcctccttcctt
gaaggtgctatggcaaccaaagccaagctgcgtcgctttaggcataacgatttagctcac
ctatccaatttattagaaaaggttgataccacaagtaacagtgacaagttagtcgtcact
gaaggtgtattcagtatggacggcgacagcgccccccttcgtgatatggcgggtatagca
aagcaaaacaaagcatggctaatggtagacgatgcccatggtatgggtgtattaggtgaa
aacgggctgggcagcgttgaagcgcaggcgttgtctcaaaccgatgttcctatcgtgatg
ggcaccttcggtaaagccgtaggaaccgcaggtgcgtttatagctggaagccaggcgctc
attgattacctagtcaattttgccaagcattatgtctattccactgccatgccaccggcc
caagcagtagcaacattatattcgttaacccatattgccgctgattcaagtcgaaccgat
gccttgaatcacaatatcgcgtattttcgtgaacggtttagtacccaaatcgggagtgca
cgttgtagcaatgatgacagcgaagacgaaaatggacacatactcaaagcgtcatcgaac
aacgcttcgtcaatcaaagcttcgtcaatcaaagcttcgtcaaatacccatcatgattta
gtcttggctaattcacatagtgcaatccaacctattattgtaggtagccctgagcgcgct
ttagcattaagtgatggcctaaaaagtcgaggcatatggatacctgctattcgctaccct
accgtaccaaaaggggaagaccgattgcgcattacactaagcgctactcatacccagcaa
gatatagacgtacttgttgatgctattgcccttgcgatggagtcgatatcatga

DBGET integrated database retrieval system