KEGG   Alteromonas naphthalenivorans: ambt_13730Help
Entry
ambt_13730        CDS       T01513                                 

Definition
(GenBank) Pseudouridylate synthase
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
alt  Alteromonas naphthalenivorans
Brite
KEGG Orthology (KO) [BR:alt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:alt03016]
    ambt_13730
Enzymes [BR:alt01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     ambt_13730
Transfer RNA biogenesis [BR:alt03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    ambt_13730
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: AEF04264
UniProt: F5Z4K5
Position
complement(3106048..3106845)
Genome map
AA seq 265 aa AA seqDB search
MPEEFPFTQCETPSEKAGSNSVQPYPPLNILYQDEHIVAIDKPPGLLVHRSPIDRHETRF
AVQTLRDQLNKHVFPAHRLDRPTSGVLLFSFDSKTAALLGQQLMNKQVQKQYHAIVRGYV
KHSGLIDYALKYRYDKIADKHKRPQQAPQQATTVYESLANYELPFAVGKYETARYSLVKL
LPSTGRKHQLRRHMVHIRHPILGDTTHGDGKQNKFLQTHFSFQNLALSCTQMGFYHPITG
KWLSVFVRMHSEMQRVLDAWQEYQV
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgcctgaagaatttccatttacccaatgtgaaaccccaagtgaaaaggctggcagcaat
agtgtgcagccatacccgccgcttaatattttatatcaagatgagcatatcgtggccatt
gataaaccgccgggtttattagtgcacagaagtcctatcgacaggcatgaaactcgcttc
gccgtgcagacattaagggatcagctcaacaagcacgtatttcccgctcaccgactagat
aggcccacatccggtgtactattgtttagttttgacagtaaaacagcggcgctgcttggc
cagcagttgatgaataagcaggtgcaaaagcagtatcacgctattgttcgtggttatgtt
aaacattcagggctcatcgattatgcgctcaaatatcgttacgataaaattgccgataaa
cataagcgcccgcagcaggcacctcagcaagccacaacggtatacgaaagtttagcgaac
tatgaattacctttcgccgtaggtaaatatgaaaccgcccgctattcattagtaaaactt
ttgccctcgacaggacgcaaacatcaattgcgtcgtcatatggtacatattaggcaccct
attttgggagataccacccacggagacggaaaacagaacaaatttttgcaaacacacttt
agttttcagaatttggccttaagttgtacgcagatgggtttttatcacccgataaccgga
aagtggctatcggtgtttgttagaatgcattcagaaatgcaacgagtgttagatgcgtgg
caagaatatcaggtttaa

DBGET integrated database retrieval system