KEGG   Alteromonas naphthalenivorans: ambt_17890
Entry
ambt_17890        CDS       T01513                                 

Definition
(GenBank) aromatic-ring-hydroxylating dioxygenase subunit beta
  KO
K14580  naphthalene 1,2-dioxygenase subunit beta [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00624  Polycyclic aromatic hydrocarbon degradation
alt00626  Naphthalene degradation
alt00627  Aminobenzoate degradation
alt00633  Nitrotoluene degradation
alt00642  Ethylbenzene degradation
alt01100  Metabolic pathways
alt01120  Microbial metabolism in diverse environments
alt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:alt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ambt_17890
   00633 Nitrotoluene degradation
    ambt_17890
   00642 Ethylbenzene degradation
    ambt_17890
   00626 Naphthalene degradation
    ambt_17890
   00624 Polycyclic aromatic hydrocarbon degradation
    ambt_17890
Enzymes [BR:alt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     ambt_17890
    1.14.12.23  nitroarene dioxygenase
     ambt_17890
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     ambt_17890
SSDB
Motif
Pfam: Ring_hydroxyl_B
Other DBs
NCBI-ProteinID: AEF05077
UniProt: F5Z5S2
Position
complement(4007567..4008154)
AA seq 195 aa
MTDTTKNNEPLALESDIAFDELIKNTQVSESLRQEVSSFLARESRLLDSRMYRTWHSEIL
SPDITYAVVSKELRSIKERRYDQPDTVYLFNDDHRQLGIRIEHDLDPQNWRSSPLERYCR
ILSNIEIGQEQGSLDLEVRSSCILTRGRRAYQVDQFFYTRTDILIRDDQGQLKLKSRYIE
YPERSISGHNMLVYL
NT seq 588 nt   +upstreamnt  +downstreamnt
atgactgatacaactaaaaataacgaaccgttagcccttgaaagtgatattgcttttgac
gaactaattaaaaacacacaggtatctgaaagtttaagacaggaggtttcttcgtttctt
gctagagagtcaagattactagactcaagaatgtataggacttggcatagtgaaatatta
agccctgatatcacttatgctgttgttagcaaagaattaagatctataaaagaacggcgc
tatgaccaacctgataccgtctatttgtttaatgatgatcatcgtcaattaggtattcgt
attgaacatgatcttgatcctcaaaactggcggagtagtccgctagaaaggtattgccgt
atacttagtaatattgaaattggccaagaacaaggcagtttagatttagaagtacgttct
tcttgtatcttaactcgtggcagaagagcctaccaagtagatcagtttttttacactcgg
actgatattctgatacgtgatgatcaaggtcaactcaagttaaaatcccgttacattgaa
tatccagagcgaagtatttctggccataatatgctggtatatctataa

DBGET integrated database retrieval system