KEGG   Alteromonas naphthalenivorans: ambt_17895
Entry
ambt_17895        CDS       T01513                                 

Definition
(GenBank) ring hydroxylating dioxygenase subunit alpha
  KO
K14579  naphthalene 1,2-dioxygenase subunit alpha [EC:1.14.12.12 1.14.12.23 1.14.12.24]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00624  Polycyclic aromatic hydrocarbon degradation
alt00626  Naphthalene degradation
alt00627  Aminobenzoate degradation
alt00633  Nitrotoluene degradation
alt00642  Ethylbenzene degradation
alt01100  Metabolic pathways
alt01120  Microbial metabolism in diverse environments
alt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:alt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    ambt_17895
   00633 Nitrotoluene degradation
    ambt_17895
   00642 Ethylbenzene degradation
    ambt_17895
   00626 Naphthalene degradation
    ambt_17895
   00624 Polycyclic aromatic hydrocarbon degradation
    ambt_17895
Enzymes [BR:alt01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.12  With NADH or NADPH as one donor, and incorporation of two atoms of oxygen into the other donor
    1.14.12.12  naphthalene 1,2-dioxygenase
     ambt_17895
    1.14.12.23  nitroarene dioxygenase
     ambt_17895
    1.14.12.24  2,4-dinitrotoluene dioxygenase
     ambt_17895
SSDB
Motif
Pfam: Ring_hydroxyl_A Rieske Img2 DAG_kinase_N
Other DBs
NCBI-ProteinID: AEF05078
UniProt: F5Z5S3
Position
complement(4008169..4009515)
AA seq 448 aa
MSNQEENLIDVNHGTQLHKMHGDQKVLEQELENVFGRSWLFLTHESIIPNHGDYVVTKMG
TDEVIVSRQENGDVKAFLNVCRHRGAQLCPHEAGNAKGFVCSYHGWGYGNTGELQAVPFD
KEVYGGLLDKCKNSLHEVAKVENYNGFIYGCFDENSPSFSDYLGDLKWFLDPYFEHSGGL
ELIGPPARCLIKANWKCSAENFVGDAYHVGWTHASALRTGESVFTPLAGNSTPPTEGLGL
QITSKFGSGLGVLWDAYAGIHDSSLINDMMQWATIKEQQLAEKIGADRARIYRSHLNTTI
FPNNSFLTGSGVFKTWQPIDKDTTEVFTWTMVEKDMPEELKQRIAMSVQRTFGVAGYWES
DDNDNMESETYMTKGFQARNKNLNAQMGIGNDVYNGKYPGVVCESAIGETSYRGYYRAYS
AFINANSWHEIEDKSSNWADILTNAKTK
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgtcaaatcaagaagaaaatttaatcgatgttaaccatggaacacaattacataaaatg
catggtgatcaaaaagttttagagcaggagcttgaaaatgtatttggccgttcatggcta
tttttaactcatgaatctataattccaaatcatggtgattatgttgttactaaaatggga
acagatgaagtaatcgttagtagacaagaaaatggtgatgttaaagcatttttaaatgtc
tgccgtcataggggcgcgcaattgtgtccacacgaagcaggtaatgctaaaggctttgtt
tgctcttaccatggctgggggtatggcaatactggtgaattacaagccgtaccttttgat
aaggaggtttatggtggcttacttgataagtgtaaaaactctctacatgaagtggcaaaa
gttgaaaattataacggcttcatttatggctgttttgatgaaaactccccatcattctct
gattatttaggcgatcttaagtggtttttagacccttactttgaacattcgggtggcctt
gaattaattggacctcctgctcgttgcctaattaaagcgaactggaaatgctcagcagaa
aactttgtgggtgatgcttaccatgttggctggacacatgcttcagcactacgtactggt
gaatcagtttttacaccactggcaggaaatagtacacctccaactgaaggtttaggtcta
caaataaccagcaaatttgggtcagggctaggtgtgctgtgggatgcttatgcaggtatt
catgatagttcattaattaacgacatgatgcaatgggctaccataaaagagcagcaatta
gccgaaaaaattggtgctgatcgtgccagaatttatcgatctcatttaaatacgactatc
tttcctaataatagctttttaacaggatcaggtgtatttaaaacttggcagcctatcgat
aaagataccacagaagtttttacctggacaatggtagaaaaagatatgccagaagaactt
aaacagcgtattgctatgtcagtccagcgtacttttggtgttgcgggttactgggaaagt
gatgataatgacaatatggaatccgaaacatacatgacaaaaggttttcaagctagaaat
aaaaatcttaatgcccaaatgggtattggaaatgatgtttacaatggtaaatatcctggt
gttgtttgtgagtccgctattggagaaacaagttatcgtggttattatcgtgcgtatagt
gcctttataaatgctaatagctggcatgagatagaagacaaaagtagtaattgggctgat
attttaacaaatgcaaaaaccaaataa

DBGET integrated database retrieval system