KEGG   Alteromonas naphthalenivorans: ambt_17910
Entry
ambt_17910        CDS       T01513                                 

Definition
(GenBank) Dihydrodipicolinate synthetase
  KO
K14585  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase [EC:4.1.2.45]
Organism
alt  Alteromonas naphthalenivorans
Pathway
alt00626  Naphthalene degradation
alt01100  Metabolic pathways
alt01120  Microbial metabolism in diverse environments
alt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:alt00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00626 Naphthalene degradation
    ambt_17910
Enzymes [BR:alt01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.45  trans-o-hydroxybenzylidenepyruvate hydratase-aldolase
     ambt_17910
SSDB
Motif
Pfam: DHDPS
Other DBs
NCBI-ProteinID: AEF05081
UniProt: F5Z5S6
Position
complement(4010665..4011660)
AA seq 331 aa
MTTQNKRKLMTVDDVHGLWAIMPTPAKEGASNWRMQDTVDLEETARVVEELIASGVNAII
STGTFGEGATLTYNEKIVFMETIVKTVNGRVPYFCGTTGLNTRDTIELTRKASEIGCDGT
MLGLPMWQLCDVPTAVQFYKDVAEACPDMAICIYANNEAFKFDFPRQFWAQVAEIPQVIT
AKYLGIGSLVPDMNLSQRKIRFLPLDVDFYAAARIAPEFCTAFWTSGAVCGPAPVLKLRD
EVKKASKTGDWDEAQKISGQIARTYATLFPNGSFKDFSTYNINLEKHRINAAGWMNAGPC
RPPYIFTPEEYLEGAYKSGKAWAELHQNLSK
NT seq 996 nt   +upstreamnt  +downstreamnt
atgacaactcaaaacaaaagaaaattaatgactgttgatgatgtacatgggctatgggcc
attatgcctacacccgcaaaagaaggtgcttctaactggcgcatgcaagataccgtcgac
ttagaagaaactgcacgtgtagtcgaagagcttattgcttcaggtgttaacgctattatt
agtacagggacgtttggcgaaggtgctacattaacttacaatgaaaaaatcgtcttcatg
gaaactatcgttaaaaccgttaatggccgtgtaccttatttttgtggcacaacaggatta
aatacgcgagacactattgagttaacgagaaaagcaagtgaaattggttgtgatggtaca
atgctaggtttgccaatgtggcaattatgtgatgtaccaactgcggttcaattttataaa
gatgttgcagaagcttgtcctgacatggcgatttgtatttatgcaaataatgaagccttt
aaatttgattttccacgtcagttttgggcgcaagtagcagaaataccacaagtaattact
gctaaatatcttggcataggttcacttgttcctgatatgaatttaagccaaagaaaaatt
agatttcttcctcttgatgtcgatttttatgctgctgctcgtattgctcctgaattttgt
accgcattttggacaagtggcgcagtatgtggccccgccccagtattaaaattacgagat
gaagtaaaaaaagcaagtaaaactggagactgggatgaagctcagaaaatttcaggacaa
attgctagaacatatgcaacattatttccaaacggctcgtttaaagatttttcaacttat
aacatcaatttagaaaaacatagaataaatgctgctggttggatgaatgcaggtccatgc
cgtcctccttatatttttacacctgaagagtatttagaaggtgcatataaatcaggtaag
gcttgggctgagttacaccaaaatctttctaaataa

DBGET integrated database retrieval system