KEGG   Alteromonas naphthalenivorans: ambt_20790
Entry
ambt_20790        CDS       T01513                                 

Definition
(GenBank) hypothetical protein
Organism
alt  Alteromonas naphthalenivorans
SSDB
Motif
Pfam: TraG_N
Other DBs
NCBI-ProteinID: AEF05649
UniProt: F5Z6Y6
Position
complement(4669419..4670987)
AA seq 522 aa
MAVDSTLELYTTLFGWFFYNSIWDVLVATGMVFLPFLGILIDTIIRSYAGEDAEEAGNTT
LRIIEVEFFIAFFVILIAAVPATPLNAVDLSFTPRAVIGTPAQPVATVANSRTTYGGGIS
FNGAPVTVNVPVFWFAVMSFSSGFNRAVMEDVPPTLDYRGYANELRDATIKDPELRHEIN
DFFRDCFIEARSKYLTERPDSAAIDAILNRYGDTDPDWIGSHVFQDIAGYYDSLRSDSIR
EGFPWSALRDVEWDASNHPVYGKPYCNEWWPRIQQAVLNDLGDIDLQSAAAEPGWDAVQR
RDVITQLALINSPPRWTTRGYDFAYGNLVDFEVGEQSGIFAAVQNAGQQGLAVYGLGKAS
ISFAAFLRVFLEAAPMVQSLVLMGLYTLLPFFILISRYKFSLLIIGALILFSVKFWTVLW
FFAWWIDQNLIQAFYPDPGSITTLFSTDLTLKRIILNFLTGGLYLILPILLSLYLGLAGI
RAASQLEGATQALTRGTSAAGNVSLRKPSFRNRSAGKNKGAK
NT seq 1569 nt   +upstreamnt  +downstreamnt
atggctgtggatagcacactcgaactctacaccaccttatttggttggtttttctataac
agcatctgggatgtacttgtcgcgacaggtatggtttttttgccttttctgggcattctg
attgataccatcattcgatcctatgccggagaagacgctgaagaagcaggcaatactacc
ttacggattatcgaagtggagttttttattgccttcttcgtaattctgatagctgcggtt
ccggcaacgccattaaatgccgttgatttatcgtttacgccaagggcggtaatcggcaca
ccagcacagccagtagcgaccgtcgccaattcgcgcactacctatggtggcggtatttct
ttcaatggtgcgccggtgaccgttaatgtgcctgtgttctggtttgccgtaatgagcttc
agttccggttttaatcgtgcggtgatggaggatgttccacctacattggactaccgaggc
tacgccaatgagttgcgagatgccactatcaaagacccggagctacgccacgagataaat
gacttttttcgagactgtttcatcgaagcgcgttcaaagtatctgactgaacgaccagac
agtgcagcgattgatgcaatactaaaccgttatggcgataccgaccccgactggatcggt
tctcatgtttttcaggatattgcggggtattacgatagcctgcggtcagactcaatcagg
gaaggttttccctggtcggcactgagagatgtggaatgggatgccagcaaccatcctgtt
tacggtaaaccttactgcaatgaatggtggcctcgtattcagcaagcggtcttgaacgat
cttggtgacatcgatctgcaatcggcagcggcagaacccggctgggatgcggtgcagcgg
cgcgatgtgattacgcaactcgccctgattaactcgccaccgcgctggacaacacgaggc
tatgactttgcttacggtaatctggtggacttcgaagttggcgaacaaagcggtattttt
gctgcggtacagaatgctgggcaacaaggcttggcggtgtatgggcttggtaaggcgtcc
atttcctttgccgcttttctgcgcgtgtttttggaagccgctcccatggttcagtcgtta
gtattgatggggctgtatacgttgttgcctttctttattctgatcagtcgttacaagttt
tctttgctcatcatcggagcgttaatcttgttctccgtgaagttttggacggtgctgtgg
ttctttgcctggtggatcgatcaaaacctgatacaagccttttatcctgatcctggcagc
atcaccacactgttcagcaccgatctcacactgaaacggattatcctgaactttctaaca
ggcggcttatatttgattttacccatcctgctttctttatatctcgggcttgctggaatt
cgcgctgcatcacagttggaaggggctactcaggcattgactcgcggtacttcagcggca
ggaaatgtcagcctgcggaagcccagttttagaaatcggtctgcgggcaaaaataaaggt
gccaaatga

DBGET integrated database retrieval system