KEGG   Alteromonas naphthalenivorans: ambt_20805
Entry
ambt_20805        CDS       T01513                                 

Definition
(GenBank) hypothetical protein
Organism
alt  Alteromonas naphthalenivorans
SSDB
Motif
Pfam: TraU
Other DBs
NCBI-ProteinID: AEF05652
UniProt: F5Z6Y9
Position
complement(4672653..4673666)
AA seq 337 aa
MNRLPVIVLSLLAVLSNPVRAFEAEPTRLTLSDITQSMTLDRSCLNYCITGVCVWLRCSI
YECSIETSIRVRHYNPDLVVSVFDKPGDNPWEEAESIYGDIERQLTDSIVALFHGAEAGG
GHRVEGGNTATDHSLRFKEVTAIGHPFSSITDFIGDSGYYCPSEAESFQPYLSSSLDALT
WRLGIPELLYIHNLIPGRRVVGSGIQQQWGAVWPRTGFINQKDDTKASAVIAQRAGNIVT
QTRQPHVYTALDGNDYNKTWLPGELIENDPDTGVWQMLAPKMDTQCYVFGENDVYRQAWS
SGRIAHDNRYAFSLWRPYQCCEAQGAYLFTVPLEICI
NT seq 1014 nt   +upstreamnt  +downstreamnt
atgaataggttgcctgtcattgtcttatctttattagcggttctcagcaacccggttcga
gcatttgaagccgaacccacaagactaacattgagcgatattacgcagtcaatgacactc
gaccgttcttgcctgaactactgcatcacaggcgtgtgcgtctggttgcgttgcagtatc
tacgagtgctcgatagaaaccagcattcgtgttcgtcactacaaccctgatttggtcgtt
agtgtctttgataaacccggtgacaatccatgggaggaagccgaatctatctatggtgat
atcgagcgccaattaactgattctattgtagcgctgtttcatggtgcagaagctggtggt
ggccatcgtgttgagggaggaaatacggccacggatcacagcttacgattcaaagaagtt
acagcaattggtcacccatttagttctatcactgatttcatcggggatagtggttattac
tgtccgtcagaggccgagtcgtttcaaccgtacctgtcatcttctctggatgcgttgacg
tggcgcttgggtatccctgaattgctctacatacataatttgatacctggccgtcgcgtt
gtcggttctggtattcagcagcaatggggtgctgtatggccgcgcacaggcttcatcaat
cagaaggacgataccaaggcttcggctgtgatagcacaacgagcaggaaacatcgttacg
caaacgcgacaaccccatgtttataccgcactggatggtaatgactacaacaaaacctgg
ctgcctggagagctgatagaaaacgatcccgatacaggtgtctggcaaatgttggcaccg
aagatggacacacagtgctatgtcttcggcgaaaacgatgtgtaccgacaggcttggtcg
tctggccgtattgcccatgataaccgatatgccttttctctatggcgaccttaccagtgc
tgtgaagcgcaaggcgcttatttgtttactgtgccactggagatttgcatatga

DBGET integrated database retrieval system