KEGG   Alteromonas naphthalenivorans: ambt_20835
Entry
ambt_20835        CDS       T01513                                 

Definition
(GenBank) hypothetical protein
Organism
alt  Alteromonas naphthalenivorans
SSDB
Motif
Pfam: DUF2895
Other DBs
NCBI-ProteinID: AEF05658
UniProt: F5Z6Z5
Position
complement(4680356..4681054)
AA seq 232 aa
MKDLLSLRNNQARNRLIATTDHIRSLRIAIVFLTLVIAALWWRNGVLQETRRLYIPPDLT
QGMVTQFDNVPAPLVYTFAYYIFQQLNRWPSDGEKDYPQQIYKLQGFMTPSCRVALEADM
NEKQRLGELRQRVRSIQEILGHSYSRSRVIFESNSSWLTWLDVNVSESINGHPVKDVRLR
YPMRVVRFDVDKEVNPWGLALDCDETMRPELLTELQIGQPFMPEVSHAVPAK
NT seq 699 nt   +upstreamnt  +downstreamnt
atgaaagatttgttatcccttcgcaacaatcaggcgcgtaaccggttaattgctactacc
gatcacatacgttcactgcgcatagccattgtatttctaaccttagtcattgctgcgttg
tggtggcgaaatggtgtcttgcaggaaacgcggaggctctatattccccctgatctgacg
caaggtatggtgacgcagttcgacaatgtgcctgcaccattggtctacaccttcgcctat
tacatctttcagcaactgaatcgctggccatccgatggtgagaaagactacccgcaacaa
atctacaagttgcagggttttatgactccgagctgtcgggtagccctcgaagccgatatg
aacgaaaagcaacgcttgggtgaacttcgccagcgcgtgcgcagtattcaggaaattctc
ggtcattcctattcccgctcgcgggtgatattcgagagtaacagttcctggcttacttgg
ctggatgtcaatgtctccgaatctatcaatggccaccccgttaaagatgtcaggctgcgc
tatcccatgcgggtggtgcgctttgatgtggataaggaagtaaatccctggggattagcg
ctggattgcgacgagaccatgcgacctgagttgctgactgagctgcaaattggtcaaccc
tttatgccggaggtgagtcatgccgtaccagcgaaataa

DBGET integrated database retrieval system