KEGG   Allochromatium vinosum: Alvin_0063Help
Entry
Alvin_0063        CDS       T01168                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
alv  Allochromatium vinosum
Pathway
alv00071  Fatty acid degradation
alv00280  Valine, leucine and isoleucine degradation
alv00310  Lysine degradation
alv00362  Benzoate degradation
alv00380  Tryptophan metabolism
alv00620  Pyruvate metabolism
alv00630  Glyoxylate and dicarboxylate metabolism
alv00640  Propanoate metabolism
alv00650  Butanoate metabolism
alv00900  Terpenoid backbone biosynthesis
alv01100  Metabolic pathways
alv01110  Biosynthesis of secondary metabolites
alv01120  Microbial metabolism in diverse environments
alv01130  Biosynthesis of antibiotics
alv01200  Carbon metabolism
alv01212  Fatty acid metabolism
alv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:alv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Alvin_0063
   00630 Glyoxylate and dicarboxylate metabolism
    Alvin_0063
   00640 Propanoate metabolism
    Alvin_0063
   00650 Butanoate metabolism
    Alvin_0063
  09103 Lipid metabolism
   00071 Fatty acid degradation
    Alvin_0063
   00072 Synthesis and degradation of ketone bodies
    Alvin_0063
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    Alvin_0063
   00310 Lysine degradation
    Alvin_0063
   00380 Tryptophan metabolism
    Alvin_0063
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    Alvin_0063
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    Alvin_0063
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    Alvin_0063
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:alv04147]
    Alvin_0063
Enzymes [BR:alv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     Alvin_0063
Exosome [BR:alv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   Alvin_0063
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: ADC61035
UniProt: P45369
Position
71187..72371
Genome map
AA seq 394 aa AA seqDB search
MNENIVIVDAGRSAIGTFSGSLSSLSATEIGTAVLKGLLARTGLAPEQIDEVILGQVLTA
GVGQNPARQTTLKAGLPHSVPAMTINKVCGSGLKAVHLAMQAIACGDADIVIAGGQESMS
QSSHVLPRSRDGQRMGDWSMKDTMIVDGLWDAFNNYHMGTTAENIAQKYGFTREQQDAFA
AASQQKTEAAQKAGRFQDEIIPIEIPQRKGDPKVFDADEFPRHGTTAESLGKLRPAFSRD
GSVTAGNASGINDGAAMVVVMKESKAKELGLKPMARLVAFASAGVDPAIMGTGPIPASTK
CLEKAGWTPADLDLIEANEAFAAQAMSVNQDMGWDLSKVNVNGGAIAIGHPIGASGARVL
VTLLYEMQKRDAKKGLATLCIGGGQGVALAVERM
NT seq 1185 nt NT seq  +upstreamnt  +downstreamnt
atgaacgagaacatcgtcatcgtcgacgccggccgcagtgccatcggaaccttcagcggc
agtctgtcgtcactctcggccaccgaaatcggcaccgccgtgctcaaggggctgctggcg
cgtaccggactcgcgccggaacagatcgacgaggtgattctcggccaggtgctgaccgcc
ggcgtgggccagaaccccgcccgtcagaccacgctgaaggccggtctgccgcactcggtt
ccggccatgaccatcaacaaggtctgcggcagcggtctgaaggcggtgcatctggcgatg
caggccatcgcctgcggggatgccgacatcgtgatcgccggcggtcaggagagcatgagc
cagtcctcgcacgtcctgccgcgttcgcgcgacggtcagcgcatgggcgactggtcgatg
aaggacaccatgatcgtcgacggtctctgggatgccttcaacaactaccacatgggcacg
accgccgagaacatcgcccagaagtacggctttacgcgcgagcagcaggacgccttcgcc
gccgcctcgcagcagaagaccgaggccgcgcagaaggccggtcgcttccaggacgagatc
attccgatcgagattccgcagcgcaagggcgatccgaaggtgttcgatgccgacgagttc
ccgcgtcacgggaccacggccgagagtctgggcaagctgcgtccggcgttctccagggac
ggcagcgtcacggcgggtaacgcctccggcatcaacgacggggcggccatggtcgtggtg
atgaaggagtccaaggccaaggaactgggtctgaagccgatggcgcgtctggtggccttc
gccagcgccggtgtcgatccggcgatcatggggacgggtccgatcccggcgtcgaccaag
tgcctggagaaggccggctggaccccggcggatctggatctgatcgaggccaacgaagcc
ttcgccgcgcaggccatgtcggtcaaccaggacatgggctgggatctgtccaaggtcaac
gtcaacggcggcgccatcgccatcggtcatccgatcggcgcctccggtgcgcgtgtgctc
gtgaccctgctctatgagatgcagaagcgcgacgccaagaagggtctggcgacgctgtgc
atcggcggcggccagggcgtggcgctggcggtcgagcggatgtga

DBGET integrated database retrieval system