KEGG   Allochromatium vinosum: Alvin_0170Help
Entry
Alvin_0170        CDS       T01168                                 

Definition
(GenBank) Indole-3-glycerol-phosphate synthase
  KO
K01609  indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
alv  Allochromatium vinosum
Pathway
alv00400  Phenylalanine, tyrosine and tryptophan biosynthesis
alv01100  Metabolic pathways
alv01110  Biosynthesis of secondary metabolites
alv01130  Biosynthesis of antibiotics
alv01230  Biosynthesis of amino acids
Module
alv_M00023  Tryptophan biosynthesis, chorismate => tryptophan
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    Alvin_0170
Enzymes [BR:alv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     Alvin_0170
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: IGPS QRPTase_C FMN_dh Babuvirus_MP
Motif
Other DBs
NCBI-ProteinID: ADC61139
UniProt: D3RVL2
Position
180384..181181
Genome map
AA seq 265 aa AA seqDB search
MTDTPDILKKIVQRKIEEISERRIRRSDADLSAALADVGPVRGFAAALQTRVAAGEPAVI
AEVKKASPSKGVLRADFHPAEIAAGYERGGAACLSVLTDVDFFQGADAYLQEARAACALP
VIRKDFIVDPYQVREARLIGADAILLIAACLSDAQLSELNALAHELGLDVLVEVHDAEEL
ERALAVPGRLIGINNRNLRTFEVTLETTLGLLEAIPEDRLLVTESGILTGEDVARMRGRG
VHAFLVGEAFMRAPDPGVELARLFF
NT seq 798 nt NT seq  +upstreamnt  +downstreamnt
atgaccgataccccggatatcctgaaaaagatcgttcagcgcaagatcgaggaaatcagc
gagcggcgcatacgccgctcagacgccgatctgagcgcggcgctggccgatgtcgggccg
gtgcgtggtttcgccgccgcgcttcaaacgcgggtcgcggccggtgagccggcggtgatc
gccgaggtcaagaaagccagtccgagcaagggcgtgctgcgtgccgacttccatccggcg
gagatcgcggcgggctatgaacgcggcggtgcggcctgtctctcggtgctgaccgatgtg
gacttcttccagggcgccgatgcctatctccaggaggcgcgcgccgcctgtgcgcttccg
gtcatccgcaaggacttcatcgtcgacccctatcaggtgcgcgaggcgcggctgatcggc
gccgatgccatcctgctgatcgccgcctgtctgtccgatgcccaactgagcgagttgaac
gcgctggcgcatgaactggggctggacgtgctggtcgaggtgcacgacgccgaagagctg
gagcgtgcgctcgcggtgcctggacggctgatcggcatcaacaaccgcaatctgcgcacc
ttcgaggtgacgctggagaccacgctcggtttgctggaagcgattccggaggatcggctg
ctcgtcaccgagagcggcatcctgaccggcgaggacgtggcgcggatgcgcggtcggggc
gttcatgccttcctggtcggcgaagccttcatgcgcgcgcccgatccgggtgtcgagctg
gcacggctgttcttctag

DBGET integrated database retrieval system