KEGG   Allochromatium vinosum: Alvin_0186Help
Entry
Alvin_0186        CDS       T01168                                 

Definition
(GenBank) oxaloacetate decarboxylase alpha subunit
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
alv  Allochromatium vinosum
Pathway
alv00620  Pyruvate metabolism
alv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    Alvin_0186
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:alv02000]
    Alvin_0186
Enzymes [BR:alv01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     Alvin_0186
Transporters [BR:alv02000]
 Other transporters
  Primary active transporters [TC:3]
   Alvin_0186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PYC_OADA HMGL-like Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 GCV_H RnfC_N
Motif
Other DBs
NCBI-ProteinID: ADC61153
UniProt: D3RVM6
Position
complement(198861..200645)
Genome map
AA seq 594 aa AA seqDB search
MTQKTPLGITDVILRDAHQSLLATRMRTEDMLPIAAKLDQVGYWSVESWGGATFDACIRY
LGEDPWDRLRQLKAAMPRTPQQMLLRGQNLLGYRHYADDVVEKFVERAALNGIGVFRIFD
AMNDLRNLERAVHAALATDAHAQGTLSYTVSPVHNIDYWVDMGRRLEDMGCHSICIKDMA
GLLRPYVAEELVTRLKATCAIPIAMQCHATTGLSTAAIVKAAEAGIDMVDTAISSMSMTY
GHSPTESVVAIMQGTERDTGLDLNLLEEIAAYFREVRKKYARFEGSLKGVDSRILVAQVP
GGMLTNMENQLREQGAADRLDEVLAEIPRVREELGFLPLVTPTSQIVGSQAVLNVLMGER
YKTITTETAGVLRGEYGATPAPVDQDLQSRVLQPGEEPITCRPADNLTAELDRLTEELEA
IARERTLKLVDPVIDDVLIYAMFPQVGLKFIENRDNPAAFEPRPWEIEDAPAGPAATTTV
ASGPEHYRIEVNGRAYDVTVSPQGTLEAVVPAGTAPVSAAVPVQAQTVASPLAGTIVKVP
VAVGQTVNAGDVVVILEAMKMETEVRAPAAGRVTDIRVKEGEAVALGAPLIALG
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgactcagaagaccccactcggcatcaccgacgtcatcctgcgcgatgcgcatcagtcg
ctgctggcgacccgcatgcgcaccgaggacatgctgcccatcgccgccaagctggatcag
gttggttactggtccgtggaatcctggggcggcgccacctttgacgcctgcatccgttat
ctgggcgaggatccctgggaccgtctgcgtcagctcaaggccgccatgccgcgcacgccc
cagcagatgctgctgcgcggtcagaatctgctcggctaccgccactatgccgacgatgtg
gtcgagaagttcgtcgagcgcgcggccctcaacggcatcggggtgttccgcatcttcgac
gccatgaacgatctgcgcaatctggagcgcgcggtccatgcggcgctggccaccgatgcc
cacgcccagggcactctgtcctataccgtcagtccggtgcataacatcgactactgggtc
gacatgggccggcggctcgaagacatgggctgtcactccatctgcatcaaggacatggcc
ggactgctgcgtccctatgtcgctgaggaactggtgacgcggctcaaggcgacctgcgcc
atcccgatcgccatgcagtgtcacgccaccaccggcctgagcacggcggccatcgtcaag
gccgccgaagccgggatcgacatggtcgacaccgccatctcctcgatgagcatgacctat
ggtcattcgccgaccgaatccgtggtcgcgatcatgcagggcaccgagcgcgacaccggc
ctggatttgaatctgctcgaagagatcgccgcctatttccgcgaggtgcgcaagaaatac
gcgcgcttcgagggttcgctcaagggcgtcgattcgcgcatcctggtcgcgcaggtgccg
ggcggcatgctgaccaacatggagaaccagttgcgcgagcagggcgcggcggaccgtctc
gacgaggtgctggccgagatcccgcgcgtgcgcgaggagctggggttcctgccgctggtc
acgccgacctcgcagatcgtcggcagtcaggcggtgctcaacgtgctcatgggcgagcgc
tacaagaccatcaccaccgagaccgccggtgtgctgcgcggcgaatacggcgccacgcct
gcgccggtcgatcaggatctgcaatcgcgcgtgctccagccgggcgaggagccgatcacc
tgccgtccggccgacaacctgacggccgagctggatcgcctgaccgaagagctggaggcg
atcgcccgcgagcgcacgctcaagctggtcgatccggtgatcgacgacgtgctcatctat
gccatgttcccgcaggtgggactgaagttcatcgagaaccgcgacaacccggcggccttc
gagccgcgtccctgggagatcgaggacgcacccgccggcccggccgccacgacgacggtc
gcgagcggtcccgagcactatcggatcgaagtcaacggccgtgcctacgatgtcacggtt
tcgccccaaggcacgctcgaagcggtcgtgccggcgggcacggcacctgtgtcggcggcg
gtgccggtccaggcgcaaacggtcgcgtccccgctcgcgggcaccatcgtcaaggttccg
gtcgctgtcggccagacggtcaacgccggggatgtggtcgtgatcctggaggcgatgaag
atggagactgaagtccgtgcacccgccgccggccgcgtgaccgatatccgcgtcaaggaa
ggcgaagccgtggcactcggcgcgccgctgatcgcactgggctga

DBGET integrated database retrieval system