KEGG   Allochromatium vinosum: Alvin_0292Help
Entry
Alvin_0292        CDS       T01168                                 

Definition
(GenBank) 2-oxoglutarate dehydrogenase, E2 subunit, dihydrolipoamide succinyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
alv  Allochromatium vinosum
Pathway
alv00020  Citrate cycle (TCA cycle)
alv00310  Lysine degradation
alv01100  Metabolic pathways
alv01110  Biosynthesis of secondary metabolites
alv01120  Microbial metabolism in diverse environments
alv01130  Biosynthesis of antibiotics
alv01200  Carbon metabolism
Module
alv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
alv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    Alvin_0292
  Amino acid metabolism
   00310 Lysine degradation
    Alvin_0292
Enzymes [BR:alv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     Alvin_0292
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding DUF3446
Motif
Other DBs
NCBI-ProteinID: ADC61255
UniProt: D3RMJ7
Position
complement(348037..349302)
Genome map
AA seq 421 aa AA seqDB search
MSLEVRVPALPESVADARVLTWSKRPGEAVREGENLVELETDKVVLEVPAPRTGVLSEIL
AAEGAMVHTDDVLALISEGAVSVAPAPKPASTPSTAPTATPTPPAAATQPNAPPHVTPSA
RQLVKELHLEPSQIPSRDGRIQKADVLAYLDAREHQAPERHPDLAAAPAAQTPVEPALAP
TPALSGEAGRPEQRVPMTRLRARIAERLLQAQQNAALLTTFNEVNLSAVNALRARYKETF
EQRHGVRLGLMSFFVKAAVEALQRFPVLNASIDGEDILYHGYYDIGIAVSSPRGLVVPIL
RNADQLGMAEVEQGIADFGQKARDGSLSYEELTGGTFSITNGGVFGSLLSTPILNPPQSA
ILGLHKIQERPIVENGQIVVAPMMYLALTYDHRLIDGRDAVQFLVAIKELLEDPARLLLR
V
NT seq 1266 nt NT seq  +upstreamnt  +downstreamnt
atgagtctcgaagtccgcgtacccgccctacctgaatccgtcgccgatgcacgggtgttg
acctggagcaaacggccgggcgaggcggtcagggagggcgagaatctggtcgagctggag
accgacaaggtggtgctggaggtgccggcgccgcgtaccggcgtgctcagcgagatcctg
gccgcagagggcgccatggtccataccgatgacgtcctggcgctgatcagcgagggggcg
gtgagcgtcgcgcccgcccccaagccggcgagcacgccaagcaccgctccgaccgcaacg
cccacgccgcccgccgcagcgacccagccgaacgcaccaccccatgtcacgccctcggca
cgtcagctggtcaaggaactgcacctggagccgagccagatccccagccgcgatggacgc
atccagaaggccgatgtgctggcctatctggatgcgcgcgaacatcaggcgccggagcgt
catcccgatctcgccgccgcaccggccgcccagacgccggtcgaacccgcgctcgcccca
acgccggcactcagtggcgaggccggccgccccgagcagcgcgtgcccatgacccgtttg
cgcgcgcgcatcgccgagcgtctgctccaggcgcagcagaacgcggcgttgctgaccacc
ttcaacgaggtcaatctgagcgccgtcaatgccctgcgcgcgcgctacaaagagaccttc
gagcaacggcatggcgtgcggctggggctgatgtcgttcttcgtcaaggcggcggtcgaa
gccctgcaacgcttcccggtgctcaacgcctcgatcgacggcgaggacatcctctatcac
ggctattacgacatcggcattgcggtcagctcgccgcgcggtctggtggtgccgatcctg
cgcaacgccgatcagctcggcatggccgaggtcgagcagggcatcgccgacttcggtcag
aaggccagggacggcagtctcagctatgaggaactcaccggcggcaccttctccatcacc
aatggcggggtgttcggctcgctgctgtcgacgccgatcctcaatccgccgcagagcgcc
atcctgggtctgcacaagatccaggagcgtccgatcgtcgagaacggtcagatcgtggtc
gcgcccatgatgtatctggcgctcacctatgaccacaggctcatcgacgggcgcgacgcg
gtgcagttcctggtcgcgatcaaggagctgctggaagatccggcgcgactgctgctgcgt
gtctga

DBGET integrated database retrieval system