KEGG   Allochromatium vinosum: Alvin_0615Help
Entry
Alvin_0615        CDS       T01168                                 

Definition
(GenBank) beta-galactosidase
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
alv  Allochromatium vinosum
Pathway
alv00460  Cyanoamino acid metabolism
alv00500  Starch and sucrose metabolism
alv01100  Metabolic pathways
alv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:alv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Alvin_0615
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    Alvin_0615
Enzymes [BR:alv01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     Alvin_0615
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1
Motif
Other DBs
NCBI-ProteinID: ADC61565
UniProt: D3RPI3
Position
complement(716655..718079)
Genome map
AA seq 474 aa AA seqDB search
MAAPFPDDFLWGAATSAYQIEGSPLADGAGPSIWHRFAHTPGRVAGHDTGDLACDHYHRS
LEDVALMAELGLSAYRFSLAWGRVLPEGRGAVNSRGLDFYERLVDALLEHGIQPMATLYH
WDLPVALHERGGWLNPDSPHWFAEYAGTVFRALDDRVPLWITLNEPWVVTVPGYLDGQLA
PGHRDLFEPPRVANHLLLAHAEAVAAYRALGRHRIGLAVNLEPQHPASPSPADLEAARRR
DAFINRWFLDALVFGRYPEELADIFGPAWPEFSAESLAKIRCPGDFIGVNYYSRGLVRAA
PEAPPLDAIRITPTDAELTAMDWEVYPEGLTETLLWLRDRYANPPLYITENGAAFDDPPP
RDGLVEDPRRVAYLRAHIRAAATALEQGVDLRGYCVWSLLDNFEWAEGYSKRFGLYQVDP
GDRTRRPKTSACFYREVIRSRGAAVRPASAPPTAGCATNAARHDATATPAARAD
NT seq 1425 nt NT seq  +upstreamnt  +downstreamnt
atggccgcaccctttccggacgacttcctctggggcgcggcgacctcggcctatcagatc
gaggggtctccgctcgccgatggtgccggacccagcatctggcaccgtttcgcgcacaca
ccggggcgggtcgccggccatgacaccggcgatctagcctgcgatcactatcatcgctct
ctggaagacgtggcgctcatggccgagctggggctgagcgcctaccgtttcagcctggcc
tggggacgggtgctgcccgaggggcggggcgcggtcaacagccgcggactggatttctac
gagcgtctggtcgatgccctgttggagcacggcatccagccgatggccacgctctatcac
tgggatctgcccgtggccctgcacgagcgcggcggctggctcaatccggacagtccacac
tggttcgccgagtatgccgggacggtctttcgagccctggacgatcgcgtaccgctctgg
atcacactcaacgaaccctgggtggtcacagtgcccggctatctggacggtcagctcgcc
cccggacaccgggatctgttcgagccgccgcgcgtggcgaaccatctgctgctggcccat
gcggaagctgtcgccgcctatcgcgccctgggacggcaccggatcgggctggcggtcaat
ctcgaaccccagcatccggcctcgccgtccccggcggatctggaggccgcccggcggcgc
gacgccttcatcaaccgctggttcctggatgcgctcgtgttcggacgctatccagaggaa
ctggccgacatcttcggtccggcctggccggagttttcagccgaatccctggcaaagatc
cgctgtccgggcgatttcatcggggtcaactactattcgcgaggtctggtccgggccgcg
cccgaggcgccgccgctcgacgcgatccgcatcacgccgacggacgccgaactgacggcc
atggactgggaggtctatcccgagggcctgaccgaaaccctgctgtggctgcgcgaccgc
tacgccaatccgccgctctatatcactgagaacggcgcggccttcgacgatccgccgcca
cgcgacgggctggtcgaagaccccaggcgtgtcgcctatctgcgtgcccacatccgggcc
gccgcgacagcgctcgaacagggcgtcgacctgcgcggttactgcgtctggtcgctgctc
gacaacttcgagtgggccgagggctattccaagcgcttcggtctctatcaggtcgatccc
ggcgaccggacgcgccggcccaagaccagcgcatgcttctatcgcgaggtcatccgttcg
cgaggggcggcggtgcgtccagcgtcggcgccgcccacagccgggtgtgcaacaaatgca
gcccgtcacgatgcgacagcaacgcccgctgctcgcgcagactga

DBGET integrated database retrieval system