KEGG   Allochromatium vinosum: Alvin_0627Help
Entry
Alvin_0627        CDS       T01168                                 

Definition
(GenBank) 2-succinyl-6-hydroxy-2,4-cyclohexadiene-1-carboxylic acid synthase/2-oxoglutarate decarboxylase
  KO
K02551  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylate synthase [EC:2.2.1.9]
Organism
alv  Allochromatium vinosum
Pathway
alv00130  Ubiquinone and other terpenoid-quinone biosynthesis
alv01100  Metabolic pathways
alv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    Alvin_0627
Enzymes [BR:alv01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.9  2-succinyl-5-enolpyruvyl-6-hydroxy-3-cyclohexene-1-carboxylic-acid synthase
     Alvin_0627
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M_2 TPP_enzyme_M
Motif
Other DBs
NCBI-ProteinID: ADC61577
UniProt: D3RPJ5
Position
complement(733957..735717)
Genome map
AA seq 586 aa AA seqDB search
MTDQGCLNLRWALALFDGLVEGGMRHLVLSPGSRSTPLVLAAQRQPALTVTPILDERSAA
FFALGVARASGRPVGLVCTSGSALAHWFPAVIEASESGIPLVLLSADRPPELRGWGANQT
IDQTRFFGVHVRAFHDPGTPEDSPGAVKLMRALGRRAAVESQGDWPGPVHLNLPFREPLV
PGPDCRIEAAPIQTESAVSDTMGTRRPARPAGWGLPQTPPRSDWMSARISHGSGRGVICC
GPGDWTADGAEALWHLAMRLEVPVLCDPLSGLRFGCASEHRLTRYDSLLRHPATAAALKP
DWVLRFGRAPVSKTLLGWLADVPTILVDAGRGWSDPNHDVRLKIDADPAAFCVWLADADP
EPGTPDPDWFARWLQAERRLERFAAEYLDQAPWCEGHLIRDLIAQVPEGEGLLCANSMPI
RQLDTWSGSRVRPLRVFGHRGASGIDGQTSTLAGLNAGGLPTTGLLGDLSFLHDLSGLPA
LRTLSRPCIVINNGGGRIFDYLPQHGLPGFETLWRTPVAVDLRALAGTFGLAHRSVSDRD
GFRQALTESMQTDRPSGLIEVVIDADLSRQIHRDFWRAVSVRRDDA
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatcagggctgtctgaatctgcgctgggcgctggccctgttcgatggactggtc
gagggtggaatgcgtcatctggtgctttcgcccggatcgcgctccacgccgctggtgctg
gcggctcagcgtcaaccggcactgaccgtcacgccgatcctcgacgagcgcagtgcggcc
tttttcgcgctgggcgtggcgcgggcctcggggcgtccggtggggctggtctgcacctcg
gggagcgcgctcgcccactggtttccggcggtcatcgaagcctcggagtccgggattccg
ctggtgctgctctcggccgatcgtccgcccgaactgcgcggctggggggcgaaccagacc
atcgaccagacccgtttcttcggcgtgcatgtgcgcgctttccatgatccgggtacgccc
gaggattcgcccggcgcagtcaaactgatgcgggcactgggtcggcgcgcggcggtcgag
agccagggcgactggccggggcctgtgcatctgaatctgccttttcgtgaaccgctggtt
ccggggccggattgccggatcgaggccgcaccgattcagacggagtcggccgtgtccgac
accatgggcacgcgacgcccggcccgtccggcgggctggggtctgcctcagactccgccc
cggtcagactggatgtcggcgcggatttcgcacggctctgggcgcggtgtgatctgctgc
gggccgggcgactggacggcggatggcgcggaggcgctctggcatctggcgatgcggctc
gaagtacccgtgctgtgcgatccgctgtcgggtttgcggttcggttgcgcctcggaacat
cgtctcacccgttacgacagtctgctccgccatccagcgaccgctgccgcactcaagccg
gattgggtgctgcgcttcggacgcgcgccggtctccaaaacactgctgggctggctggcg
gatgtcccgacgattttggtcgacgccgggcgcggctggagcgatcccaatcatgacgtc
cgactcaagatcgacgccgatccagccgccttttgcgtctggcttgctgacgcggatccg
gaacccggcacaccggacccggattggttcgcgcgctggctccaggccgaacgccgtctg
gagcgcttcgccgccgagtatctcgatcaggcgccctggtgcgagggacacctgatccgc
gatctcatcgcccaggtgcccgagggcgaaggattgctgtgcgccaattccatgccgatc
cgccagctcgacacctggtcgggcagtcgcgttcggccactcagggtctttggccatcgc
ggcgcgagcggcatcgacggtcagacctcgacgctggccggactcaacgccggaggactc
ccgaccaccgggctgctcggtgatctgtccttcctgcacgatctcagcggactgccggca
ctgcgcacgctctcacggccctgcatcgtcatcaacaacggcggcgggcgcatcttcgac
tatctgccccagcatgggctgcccggcttcgagacgctgtggcgcacgccggtcgcggtc
gacctgcgagccctggcaggaaccttcgggctggcccatcgctcggtttccgatcgcgac
gggttccgccaggccttgaccgaatccatgcagacggaccgtccgtcaggactgatcgag
gtcgtcatcgacgccgatctgagtcgacagatccatcgcgatttctggcgggccgtcagt
gtgcggcgtgacgatgcctga

DBGET integrated database retrieval system