KEGG   Allochromatium vinosum: Alvin_0752Help
Entry
Alvin_0752        CDS       T01168                                 

Definition
(GenBank) MCP methyltransferase/methylesterase, CheR/CheB
  KO
K13924  two-component system, chemotaxis family, CheB/CheR fusion protein [EC:2.1.1.80 3.1.1.61]
Organism
alv  Allochromatium vinosum
Pathway
alv02020  Two-component system
alv02030  Bacterial chemotaxis
Module
alv_M00506  CheA-CheYBV (chemotaxis) two-component regulatory system
Brite
KEGG Orthology (KO) [BR:alv00001]
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    Alvin_0752
 Cellular Processes
  Cell motility
   02030 Bacterial chemotaxis
    Alvin_0752
Enzymes [BR:alv01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.80  protein-glutamate O-methyltransferase
     Alvin_0752
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.61  protein-glutamate methylesterase
     Alvin_0752
Two-component system [BR:alv02022]
 CheA family
  CheA-CheYBV [MD:M00506]
   Alvin_0752
Bacterial motility proteins [BR:alv02035]
 Flagellar system
  Chemotaxis proteins
   Two component system proteins
    Alvin_0752
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: CheR CheB_methylest PAS_10 CheR_N PAS_4 Fez1 IncA CENP-F_leu_zip ATG16 Spc7 AIP3 TPR_MLP1_2 WEMBL DUF3450 Exonuc_VII_L Golgin_A5 PI3K_P85_iSH2 DUF3584 IL12 TBPIP Methyltransf_12 FapA Prefoldin_3 FAM117 Med30 Mnd1 AAA_13 V_ATPase_I IFT57 APG6 Leu_zip HAUS-augmin3 ADIP Tropomyosin HMMR_N Prominin EURL DUF4795 Seryl_tRNA_N OmpH Laminin_II Atg14 HIP1_clath_bdg HemX
Motif
Other DBs
NCBI-ProteinID: ADC61699
UniProt: D3RQ94
Position
complement(876575..879214)
Genome map
AA seq 879 aa AA seqDB search
MSVRAVAPIVGIGASAGGLEDLDRFFGQVPPDSGLSFVVVLHLDPAHKGHLAERLQRCTT
LQVEQVDESVRVSPDHVYLIAPNTGLSLRQGVLHRVGPAPMHGQHLPIDVFFRSLAQDRQ
EHSIGLVLSGMGRDGTLGLCAIKDAGGLTLVQDPAEARFDDMPRSAIAAGLADIVAPAED
LYGQLQACLRQARPPRPQRAVPPPSAMPDDLDTVIILLRNHTGHDFSLYKRSTLQRRVER
RQRLHQLDEIAHYVRYLQDNPLEREQLFKEFLIGVTSFFRDPAAWDHLRDVVIPELLERR
PSGAQIRAWVAGCSTGEEAYSLGIVFREAIERLSPPQSHSLQIFATDLDPVAIARARQGF
YPLSIAADVSPERLQRFFTQENGSGYRIGKEVRELVIFAEQNVIQDPPFTRIDLIICRNL
LIYMKMELQRQLLSLFHYSLNPGAVLFLGSAETVSGSGECFHTLDSKWRFFRRETPSLGQ
APMHFNFPTLKALPANTATMTEGTQPIDLKALLNQVLLERVTPVTILANPHGEILYTTGR
TGQYLEPPVGHASLNLFVMAREGLREVLPGLCRQAQKQPEGEPVLQRSVHVRTNGSFQWV
DVAVHDLRDPAPLRGMLLVVFNEAPEPATKRRRTHRSGTAQPSAPEEREIQRLREALQST
REQMQTSQEELKSANEELQSTNEELQSTNEELTTSKEEMQSLNEELQTVNIELQAKVDDL
SRVNDDMKNLLDSTEIATLFLEEDLRIRRFTSQAAKLINLIPGDVGRPVTQIASELLYPE
LAQDVAEVLRTLVFSEKLIGTQDGRWFNARILPYSTLDNRIDGVVVTLVDMTKAKRLENE
LRQALKELSRLAGVSATDQGGDAATNPPKHDDPSAVADA
NT seq 2640 nt NT seq  +upstreamnt  +downstreamnt
gtgtctgttcgagctgtagcacccatcgtcggcatcggcgcttcggccggcggtctggaa
gacctggatcgattcttcggtcaggttccacccgacagcggactgtccttcgtcgtcgtc
ctgcacctcgatccggcacacaagggccatctggccgaacgcctgcaacgctgcacgaca
cttcaggtggagcaggtcgacgagtccgtccgggtcagtcccgatcatgtctatctgatc
gcacccaacacgggtctgtcactccggcagggtgtgctgcatcgtgtcgggccggccccc
atgcacggccagcacctacccatcgatgtcttctttcgctcgctcgcgcaggatcggcag
gaacacagtatcggcctcgttctctcgggtatgggccgcgacggcaccctgggattgtgc
gcgatcaaggacgccggcggtctcaccctggtccaggatcctgcagaggcccgattcgac
gacatgccgcgcagcgccatcgctgccggtctcgccgacatcgtggcaccggccgaagac
ctgtacggccaactccaggcctgtctgcgccaagccagaccgccaagaccgcaacgggcc
gttccgcctccgtctgcgatgcccgatgatctggatacggtgatcatcctgctacgcaat
cacaccggacatgacttctcgctgtacaagcggagcaccctccagcgtcgcgtcgaacgg
cgccagcgtctgcaccagctcgacgagatcgcgcactatgtccgctatctccaggacaac
ccactggagcgcgaacaactgttcaaggaattcctgatcggcgtcaccagcttctttcgc
gatcccgccgcctgggaccatctgcgcgacgtcgtgatccccgaactcctggagcgccgg
cccagcggcgcccagatccgcgcctgggtcgccggctgttccaccggcgaggaagcctat
tcactgggcatcgtctttcgcgaggcgatcgaacggctgtccccgccccagtcccattcg
ctccagatcttcgccacggatctcgacccggtggccatcgccagagcacgacagggtttc
tacccgctgagcatcgccgccgacgtctcgccggagcggttgcagcggttcttcacccag
gagaacggcagcggttatcgcatcggcaaggaggtgcgcgagctggtgatcttcgccgag
cagaacgtcatccaggatccgcccttcacacggatcgacctgatcatctgccgcaatctg
ctcatctacatgaagatggagttgcagcgccaactgctatcgttgtttcattacagtctc
aaccccggcgcggtcctgttcctgggttcggccgagacggtcagcggctcgggcgagtgt
tttcacaccctggacagcaagtggcgtttcttccgccgcgagaccccgagccttggtcaa
gccccgatgcatttcaacttcccgacactcaaggcactgcccgcgaacacggcgacgatg
accgaggggacacaacccatcgacttgaaggcactcctcaatcaagtgctgctggagcgc
gtgaccccagtaaccatcctcgccaacccgcatggcgagatcctctacaccaccggacgc
acgggccagtatctggagccgcccgtcggtcatgccagcctgaatctcttcgtcatggcg
cgcgagggtctgcgcgaagtcctgcccggcctctgccggcaggcacaaaagcagcccgag
ggcgagccggtccttcagcggagtgtgcatgtcaggaccaacggcagcttccagtgggtc
gacgttgccgtacatgatctgcgcgaccccgcgccactgcgcggcatgctgctcgtggtc
ttcaacgaggcgcccgagccggccaccaagcggcggcgtacccacaggagcggcacggcc
cagccatccgcaccggaggaacgcgagatccagcgtctacgcgaggcgctgcaaagcacc
cgcgagcagatgcagacctctcaggaggagctgaagtcggccaatgaggagttgcagtcc
accaacgaggagctgcaatcgaccaacgaggaactcaccacctccaaggaggagatgcag
tcgctcaacgaggagctacagaccgtcaacatcgagctgcaagccaaggtggacgatctc
tccagagtcaacgacgacatgaagaatctcctcgacagcaccgagatcgccaccctgttc
ctggaggaggatctgcgtatccggcgcttcacctcccaggcggccaagctcatcaacctg
atccccggcgacgtcggacgaccggtcacccagatcgcctccgaactgctctatcccgaa
ctggcccaggacgtggccgaggtgctgcgcaccctggtcttcagcgaaaagctcatcggc
acccaggacggacgctggttcaacgcgcgcatcctgccctacagcacgctggacaaccgt
atcgacggcgtggtcgtcaccctggtcgacatgaccaaggccaagcggctggagaacgag
ttgcgtcaggctctgaaggagctcagccgtctggccggtgtgtcagcgacggaccagggc
ggggatgcggcaaccaatccgcccaaacacgatgacccatcagccgtcgctgatgcttga

DBGET integrated database retrieval system