KEGG   Allochromatium vinosum: Alvin_1201Help
Entry
Alvin_1201        CDS       T01168                                 

Definition
(GenBank) methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
alv  Allochromatium vinosum
Pathway
alv00450  Selenocompound metabolism
alv00970  Aminoacyl-tRNA biosynthesis
alv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:alv00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    Alvin_1201
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Alvin_1201
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:alv01007]
    Alvin_1201
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:alv03016]
    Alvin_1201
Enzymes [BR:alv01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     Alvin_1201
Amino acid related enzymes [BR:alv01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   Alvin_1201
Transfer RNA biogenesis [BR:alv03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    Alvin_1201
 Prokaryotic type
   Other AARSs
    Alvin_1201
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: ADC62140
UniProt: D3RSI1
Position
complement(1386723..1388774)
Genome map
AA seq 683 aa AA seqDB search
MSQPRDILITSALPYANGPIHIGHLVEYIQTDIWARFQKMRGHNCWYVCADDAHGTPIML
RARQEGITPEQLIARVAEEHQADFAAFRVGFDNYHSTHSPENQHYATLIYERNRDAGHIA
KRMITQAYDPVEQMFLPDRFIKGECPKCGAPDQYGDNCEACGASYSPAELKNPRSAVSGA
VPEQRESDHYFFRLGDFETMLKEWTRGGSLQKEVANKLDEWFEAGLQEWDISRDAPYFGF
EIPDHPGKFFYVWLDAPIGYMASFQNLCDKTPGLDFDRFWGRDSTAELYHFIGKDIIYFH
ALFFPAMLHGAGFRTPSAIFAHGFLTVDGQKMSKSRGTFIKARTYLDHLNPEYLRYYFAA
KLGSSVDDIDLNLEDFTARVNADLVGKVVNIASRCAGFIGKRFDGRLSGALAEPELFAEF
IAAGDSIAAAYEKREFSRAVREIMALADRANQYIDEKAPWVVAKQDGREAELQDICSMGL
NLFRVLIGYLRPILPATAAESESFLRIDPLTWEALATPLIDHVIAPFKPLMTRVDPKQIE
AMLEASKEDLSATGSTVAAAAPAAVNPHLERDPVAAPIDYDSFAKVDLRVALIREARLVE
GADKLLQLTLDLGGETRNVFAGIRSAYDPKELEGRMTVMVANLAPRKMRFGVSEGMVLAA
GPGGKDLFILSPDSGAEPGMKVK
NT seq 2052 nt NT seq  +upstreamnt  +downstreamnt
atgagccagccccgcgacatcctcatcaccagcgccctcccctatgccaacggcccgatc
cacatcggccatctggtcgagtacatccagaccgacatctgggcgcggttccagaagatg
cgcggtcacaactgctggtacgtctgcgccgacgacgcccacggcacgccgatcatgctg
cgcgcgcgccaggagggcatcacgcccgagcagctcatcgcccgggtcgccgaggagcat
caggccgacttcgccgccttccgcgtcggcttcgacaactatcactcgacccactcgccc
gagaaccagcactacgcgaccctgatctacgaacgcaaccgcgatgccggacacatcgcc
aagcgcatgatcacccaggcgtatgatccggtggagcagatgtttctgcccgatcgcttc
atcaagggcgagtgccccaagtgcggcgcgcccgatcagtacggcgacaactgcgaggcg
tgcggggcgagctattcgccggccgagctgaagaatccgcgctcggcggtctcgggcgcg
gtgcccgaacagcgcgagtcggatcactatttcttccggctcggcgatttcgagacgatg
ctcaaggaatggacgcgcggcggcagtctccagaaggaggtcgccaacaagctcgacgaa
tggttcgaggccggactccaggagtgggacatctcgcgcgatgcgccctacttcggcttc
gagatcccggaccatccgggcaagttcttctatgtctggctggatgcgcccatcggctac
atggccagtttccagaacctgtgtgacaagacgcccggactggacttcgaccgcttctgg
ggccgggactcgaccgctgagctctatcacttcatcggcaaggacatcatctatttccat
gccctgttcttcccggccatgctgcacggggccggcttccgtacgccgagcgccatcttc
gcccacggcttcctcaccgtcgacggacagaagatgtccaagtcgcgcggcaccttcatc
aaggcgcgcacctacctggatcacttgaatcccgagtatctgcgttactacttcgccgcc
aagctggggtcgagcgtcgacgacatcgacctgaacctcgaagacttcacggcgcgcgtc
aacgccgatctggtcggcaaggtggtcaacatcgccagccgctgcgccgggttcatcggc
aagcggttcgacgggcggctctcgggcgcgctggccgaacccgagctgttcgctgagttc
atcgcggccggtgactcgatcgcggcggcgtatgagaagcgcgagttcagccgtgccgtg
cgcgagatcatggcgctggccgaccgcgccaatcagtacatcgacgagaaggcgccctgg
gtcgtggccaagcaggacggacgcgaggccgagttgcaggacatctgctccatgggactc
aacctgttccgggtgctgatcggctatctgcgccccatcctgcccgccacggcggccgag
tccgagtccttcctccggatcgatccgctcacctgggaggcgctggccacgcccctgatc
gatcacgtcatcgctcccttcaaaccgctgatgacgcgcgtcgacccgaagcagatcgaa
gccatgctggaggcgtccaaggaagacctgagcgccaccgggtcgacagtggccgccgcc
gctccggccgcagtcaatccgcacctcgaacgcgaccccgtcgccgcgccgatcgactac
gacagctttgccaaggtcgacctgcgcgtggccctgatccgcgaggcccgtctggtcgag
ggcgccgacaagctgctgcaactcacgctcgaccttggcggcgagacgcgcaacgttttc
gccggcatccgctcggcttatgaccccaaggaactcgaaggccggatgacggtcatggtc
gccaacctggctccgcgcaagatgcgcttcggcgtctccgagggcatggtgctggcggcc
ggtccgggcggaaaggatctcttcatcctcagcccggattcgggggccgagccggggatg
aaggtaaagtga

DBGET integrated database retrieval system