KEGG   Allochromatium vinosum: Alvin_1848Help
Entry
Alvin_1848        CDS       T01168                                 

Definition
(GenBank) isocitrate lyase
  KO
K01637  isocitrate lyase [EC:4.1.3.1]
Organism
alv  Allochromatium vinosum
Pathway
alv00630  Glyoxylate and dicarboxylate metabolism
alv01100  Metabolic pathways
alv01110  Biosynthesis of secondary metabolites
alv01120  Microbial metabolism in diverse environments
alv01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    Alvin_1848
Enzymes [BR:alv01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.3  Oxo-acid-lyases
    4.1.3.1  isocitrate lyase
     Alvin_1848
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ICL PEP_mutase
Motif
Other DBs
NCBI-ProteinID: ADC62773
UniProt: D3RUB4
Position
complement(2123092..2124399)
Genome map
AA seq 435 aa AA seqDB search
MNRQDQIQAIERDWAENPRWTDVERGYSAADVVRLRGSVQPEYTYAKLGAEKLWKRIRGE
SKKGYVNCMGAITGGQAMQQAKAGIEAIYLSGWQVAADGNTSETMYPDQSLYAYDSVPTM
VRRINNSFKRADEIQWSRGIGPGDEGYIDYFLPIVADAEAGFGGVLNAFELMKNMIANGA
AGVHFEDQLAAVKKCGHMGGKVLVPTREAVQKLIAARLAADVMGVPTLLLARTDAEAANL
LTSDVDDNDRPFVTGARTDEGFYVVKNGLEQAISRGLAYAPYADLVWCETGTPDLGFARE
FAQAVLGANPNKLLAYNCSPSFNWKKNLDDRTIARFQEELADMGYKYQFITLAGIHSMWY
NMFDLAYDYARGEGMRHYVEKVQGPEFAAREKGYTFVSHQQEVGAGYFDDVTTVIQGGQS
SVTALTGSTEEEQFH
NT seq 1308 nt NT seq  +upstreamnt  +downstreamnt
atgaaccgccaagatcagatccaggccatcgaacgtgactgggccgagaacccccgctgg
accgatgtcgagcgcggctacagcgccgccgacgtggtgcgtctgcgcggctcggtgcag
cccgagtacacctacgccaagctgggcgccgagaagctctggaagcggatccgtggcgag
tccaaaaagggctatgtcaactgcatgggcgccatcaccggcggtcaggcgatgcagcag
gccaaggccggcatcgaggccatctatctctcgggctggcaggtcgccgccgacggcaac
acctccgagaccatgtaccccgaccagtcgctctacgcctatgactcggtcccgaccatg
gtgcggcgcatcaacaacagcttcaagcgcgccgacgagatccagtggtcgcgcggcatc
ggtcccggcgacgagggctacatcgactacttcctgccgatcgtggccgatgccgaggcc
ggtttcggcggcgtgctcaacgctttcgagctgatgaagaacatgatcgccaatggcgcc
gccggtgtccatttcgaggatcagctcgcggcggtcaagaagtgcggtcacatgggcggc
aaggtgctggtgcccacgcgcgaggcggtgcagaagctgatcgcggcgcgtctggctgcc
gacgtcatgggcgtgccgaccctgctgctggcgcgcaccgatgccgaggcggccaacctg
ctcaccagcgatgtcgacgacaacgaccgtcccttcgtcaccggcgcgcgcaccgatgag
ggcttctatgtcgtcaagaacggtctggagcaggccatcagtcgcggactggcctatgcg
ccctatgccgatctggtgtggtgtgagaccggcacgccggatctcgggtttgcgcgtgag
ttcgctcaagccgtgctgggcgcgaatcccaacaaactactggcctacaactgttcgccc
tcgttcaactggaagaagaacctggacgatcgcaccatcgcgcgattccaggaagagctg
gccgacatgggctacaagtaccagttcatcacgctcgccggcattcacagcatgtggtac
aacatgttcgatctggcctacgactatgcgcgcggcgagggcatgcgccactatgtcgag
aaggtccaggggccggagttcgccgcgcgcgagaagggttacaccttcgtctcgcatcag
caggaagtgggcgccggttacttcgacgacgtgaccacggtcatccagggcggtcagtcg
tccgtcacggcgctgaccggctcgaccgaggaagagcagttccactga

DBGET integrated database retrieval system