KEGG   Allochromatium vinosum: Alvin_2723Help
Entry
Alvin_2723        CDS       T01168                                 

Definition
(GenBank) asparagine synthase (glutamine-hydrolyzing)
  KO
K01953  asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
alv  Allochromatium vinosum
Pathway
alv00250  Alanine, aspartate and glutamate metabolism
alv01100  Metabolic pathways
alv01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:alv00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    Alvin_2723
Enzymes [BR:alv01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.4  asparagine synthase (glutamine-hydrolysing)
     Alvin_2723
Peptidases [BR:alv01002]
 Cysteine Peptidases
  Family C44
   Alvin_2723
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Asn_synthase GATase_7 GATase_6 QueC HHA NAD_synthase tRNA_Me_trans
Motif
Other DBs
NCBI-ProteinID: ADC63632
UniProt: D3RQ21
Position
3084391..3086208
Genome map
AA seq 605 aa AA seqDB search
MCGIAGFMLARGRRPEPEWLDRMAERLAHRGPDDRGRYCAGPVGLVQTRLSIIGLESGHQ
PLLSADGQLALVANGEVYNYIELNAELRALGQPPRTGSDSETILNAYAAHGLDALDRLRG
MYAFALHDARAGRLILGRDRLGIKPLFYVRLPDRIAFASEIKALLALLPESPRIQPSALR
QFLQNQFAGGEETLIDGIRRVPPGTALLIDADLNIRPHRYWLALDVEPRRIGFEEARAEL
DALMDDAMREHQRSDVPFGLFLSGGLDSAVLAAKLAEQGAGRIKSYSVGYRGTAMAHELD
EAARVATHFGFDHRPLELELPRVFGRLPHTVWCADELMRDYACLPTSILAETAGAELKVV
FSGEGGDEAFAGYGRYRPPLAERLLKSLLHPGSGGFRTRGQWAGRWTRRLMGPALRAVAD
ADRAPVRRAWSETPRHWSDMQRRQYTDLVTALPDNLLVKTDRLLMGFGLEGRVPFLDHRI
VEFGLSLPDALKVQGHQGKWLVRRWAEPKLPPGHLERPKRGFHVPVGDWLRGSLATEVGR
RLALNPGVRDWFEVTAIPELVAARQAGRGGGRELFGLMQFAIWHRLFIERPGLRPTPDED
PLDWI
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgtgcggcatcgccggattcatgctggctcggggccggcgccccgaacccgagtggctc
gatcgtatggccgaacggctggcgcaccgcggcccggacgaccggggccgttattgcgcc
gggccggtcggtctggtgcagacgcggctgtcgatcatcggactggagagcggccatcag
ccgctgctgtcggcggacgggcagctcgcgctggtcgccaacggcgaggtctacaactac
atcgagctgaatgccgaactgcgcgcgctcggccagccgccgcgcaccggctcggactcc
gaaaccatcctcaacgcctatgccgcgcatggactcgacgcgctcgaccgattgcgtggg
atgtatgcttttgcgctccatgatgcgcgcgccggacgcctgatcctcggacgcgaccgg
ctcggcatcaagccgctgttctatgtccggctgcccgaccggatcgcgtttgcttccgag
atcaaggcactgctggcgctcctgcccgagtcgccccgaatccagccgagcgcgctgcgc
cagttcctgcaaaaccagttcgccggcggcgaggagacgctgatcgacggcatccggcgc
gtcccgccgggcacggcgctgctgatcgacgccgatctgaacatccgcccgcatcgctac
tggttggcgctggatgtggagccgcgtcggatcggcttcgaggaggcacgcgccgaactg
gacgccctgatggacgacgccatgcgcgagcaccagcgttcggatgtgccattcggactc
tttctctccggcggactggactcggcggtgctggccgccaagctcgccgaacagggcgcc
ggacgcatcaagagctattcggtcggctatcgcggcacggccatggcgcatgaactcgac
gaagcggcgcgcgtggccacgcacttcggcttcgatcaccgaccgctcgaactggagctg
cccagggtcttcggacgcctgccgcatacggtctggtgcgccgatgagctgatgcgcgat
tacgcctgtctgccgacctcgatcctggccgagacggcgggcgcggagctgaaggtggtg
ttttcgggcgaagggggcgacgaggcgttcgccggttacgggcgctatcgtccgccgctg
gccgagcggctgctgaagtcgctgctgcatccgggcagcggcggattccgcacccgtggc
cagtgggccggacgctggacgcggcgtctcatgggaccggccctgcgcgcggtcgccgac
gccgatcgtgcacccgtccggcgcgcctggagcgagacgccccgccactggtcggacatg
cagcgccgccagtacaccgatctggtcacggcgctaccggacaatctgctggtcaagacc
gaccggttgctgatgggattcgggctggaggggcgtgtgccctttctcgatcatcggatc
gtcgagttcgggctgtcgctgccggacgcactcaaggtgcaggggcatcagggcaagtgg
ctggtgcggcgctgggccgagccgaaactgccgcccggccatctggagcggcccaagcgc
ggctttcatgtcccggtcggagattggctgcgcgggagtctggccaccgaggtcgggcga
cggctggcgctcaatccgggcgtgcgcgactggttcgaggtcacagccatccccgagctg
gtcgccgcgcgtcaggccggacgcggcggcggacgcgagttgttcggactgatgcagttc
gccatctggcaccggctgttcatcgagcgccccggactcaggccgacacccgatgaagat
ccgctcgactggatctaa

DBGET integrated database retrieval system