KEGG   Allochromatium vinosum: Alvin_3090Help
Entry
Alvin_3090        CDS       T01168                                 

Definition
(GenBank) exodeoxyribonuclease V, gamma subunit
  KO
K03583  exodeoxyribonuclease V gamma subunit [EC:3.1.11.5]
Organism
alv  Allochromatium vinosum
Pathway
alv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:alv00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03440 Homologous recombination
    Alvin_3090
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:alv03400]
    Alvin_3090
Enzymes [BR:alv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Alvin_3090
DNA repair and recombination proteins [BR:alv03400]
 Prokaryotic type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Alvin_3090
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Exonuc_V_gamma RecC_C
Motif
Other DBs
NCBI-ProteinID: ADC63990
UniProt: D3RS53
Position
3480112..3483714
Genome map
AA seq 1200 aa AA seqDB search
MHPEDLSPAADWPTGFMLIQGNRLEELRGLLVAWMHRHPLAPLENETILVQSNGIAQWLK
LALAATPTSDDRDAITGGQGIAAALDVMLPARFIWRVYRAVLGDLPETSPFDKAPLTWRL
YRLLERLTGVAPLQSSDTRFDALDPLRGFLAVDGQEAAPRRRYQLAERLADLFDQYQVYR
ADWLEAWSQGRDVLIRPNGERRSIPVGQDWQPVLWRALQADVDAEHGPDDPPLRHASRAE
VHRVFLERTRAGQDADPTRIAALRSVELPRRVIVFGLSSLPRQMLEALEAIAPVCQVMLF
VLNPCRHYWGDIIEGRDLFRHPYRRQTARKVPENLDESRLHLNGHPLLAAWGKQGRDYIR
LLDEQDERRRYEAYFQGLTARDQGIDLFASPGTGSLLHQLQDDILELRPLHERQDQRTVI
DPEHDRSLEFIVAHSPQREIEILHDRLLDAFERSARTDRPLQPREVLVMVPDIAVHAPHI
QAVFGRFDPDDRRAIPFQITDQGQRHRNPLVIGLEHLLNLPRARFAVSELLDLLDIPALR
TRFSLDEPDLPRLRLWIAGANVRWGLDAAQRASLGLPEGLEQNTWRFGLRRLLLGFASGD
AGPWRDIEPHDEVGGLEAALLGPLAQLLERLEAYWQCLTEPRTPAGWSALISALLDDFFM
ETSESDGVTLARILLELDAWEADCVQGGLGAEPIALEIVRDSLLARLDRPSLTQRFLGGA
VNFATLMPMRAIPFRQIWLLGMNDGDYPRRRVPADFDLMAGDYRPGDRSRREDDRYLFLE
ALLSAREKLVIGWVGRGIRDNSERPPSVLVGQLRDHLAAGWRRPDGDGARLLAALTSVHP
LQPFGRGYFEPGRAKTLFTYAREWRAVHDGAGTTEVSAERLAPWLPETPVDLDQLQGFLR
DPIMALFDQRLRIKAPGEVVAPPDVETFALDGLGDWQIKDELISRTFEPGLDRPALEQRL
QAGIARFQAQGRLPDGSLGERLGRTVIAYLPVLHAAWDAALSEWPRRLDRPIPVMVEVNV
PAGRLVLEDVLSDLREGDDGRGQIILQTSGLTKDKHYQWRNTLRAWVRHLAAQLDGEPVT
TRLLTPSGDARLEPVPVDEARERLEALLVVWWEGMQRPLPVALNAGMAWLDKDGPETLED
GTAPEELKAWNAALQAFDLDHTYNAYVGRCYDSFEALWSGVEFARWAHRLYGGLRTTISR
NT seq 3603 nt NT seq  +upstreamnt  +downstreamnt
atgcaccctgaagatctctccccagcggccgattggccgaccggcttcatgctgatccag
ggcaaccggctggaggagttgcgaggattgctggtggcctggatgcaccgtcatccgctc
gcgccgctggagaacgaaaccatcctggtgcagagcaacggcatcgcgcagtggctcaag
ctggctctggccgccacgccaacgtctgacgaccgtgatgccatcacggggggccaggga
atcgccgccgcactggacgtgatgttgccggcgcgtttcatctggcgcgtctaccgcgcc
gtgctcggcgatctgcccgagacctcgcccttcgacaaggctccgctgacctggcggctg
tatcgtctgctcgaacggctcacaggggtggcgccgctccagtcgagcgacacccgcttc
gatgcgctcgacccgctgcgcggctttctcgcggtcgatggccaggaggccgccccgcgc
cggcgctatcagctcgccgaacggctcgcggacctgttcgatcagtatcaggtctatcgg
gccgactggctggaggcctggagtcaggggcgtgatgtcctgatccgcccgaacggcgag
cggcggtcgattcccgtgggtcaggactggcagccggtgttgtggcgtgcgctccaggcc
gacgtggacgccgagcatggcccggacgatccgccgctgcgtcatgccagccgcgccgag
gtccatcgggtctttctggagcgtaccagggccggtcaggacgcggacccgacgcggatc
gcggctctgcgttcggtcgagctgccgcgccgggtcatcgtcttcggtctctcctcgctg
ccgcgccagatgctggaggcgctggaggcgatcgcgcccgtgtgccaggtgatgctgttc
gtgctcaatccatgccggcattattggggcgatatcatcgaagggcgggatctgttccgc
catccctaccggcgtcagacggcacgcaaagtgcccgagaacctcgacgagagccggctc
catctcaacggccatccgctgcttgcggcctggggcaaacagggacgcgactatatccgc
ctgctcgacgagcaggacgagcggcgccgctacgaagcctatttccagggactcaccgcc
cgcgatcaggggatcgacctgttcgcctctcccggcaccggcagcctgctgcaccagttg
caggacgacatcctggagctgcgtccgctccacgaacgccaggaccagcggaccgtcatc
gaccccgagcacgaccgcagtctggagttcatcgtcgcccacagtccgcagcgcgagatc
gagatcctgcacgaccggctgctcgatgcgttcgagcgctcggcacgcaccgaccgtccg
ctccagccgcgcgaggtgctggtgatggtgccggacatcgccgtccatgccccgcacatc
caggccgtcttcggccgcttcgaccccgacgaccggcgcgccatcccgttccagatcacc
gatcaggggcagcgtcatcgcaacccgctggtcatcggtctggagcatctgctgaatctg
ccgcgcgcccgcttcgccgtcagcgagctgctcgacctgctcgacatcccggccctgcgc
acgcgcttcagtctcgacgagcctgatctgccgcgcctgcgcctgtggatcgccggggcc
aatgtgcgctgggggctggatgcggcccagcgtgccagtctcgggctgcccgaggggctg
gagcagaacacctggcgcttcggactgcgccggctgctgctgggattcgccagcggtgac
gccggaccctggcgcgacatcgagccgcacgacgaggtcggcggactggaggcggcgctc
ctgggaccgttggcgcagttgctcgaacggctggaagcctactggcagtgtctgaccgag
ccgcgcacgccggccggctggagcgccctgatcagcgccctgctggacgatttcttcatg
gaaacgagcgagtccgatggggtcacgctcgcgcgtatcctgctcgaactcgacgcctgg
gaggccgactgcgtccaggggggtctgggcgcggaacccatcgcactggagatcgtccgc
gattcgctcctggcccggctcgatcggccgagcctgacgcagcgcttcctgggcggggcg
gtcaacttcgcgaccctgatgccgatgcgcgccattcccttccgccagatctggctgctg
ggcatgaacgatggcgactatccgcgtcggcgcgtgccggccgacttcgatctgatggcc
ggcgactatcggccgggagatcgctcgcggcgtgaggacgaccgctatctgtttctggaa
gcgttgctgtcggcgcgcgagaagctggtcatcggctgggtcgggcgcggcatccgcgac
aacagcgagcgtccgccctcggtgctggtcggacagttgcgcgatcatctggcggccggc
tggcgtcggcccgatggcgacggcgcccggctgcttgccgcgctgaccagcgtgcatccg
ctccagccgttcgggcgcggctatttcgagccggggcgggcgaagacgctcttcacctat
gcgcgcgagtggcgggcggtgcacgatggtgccggaacgacggaggtcagcgccgagcgg
cttgcgccctggttgcccgaaacgccggtcgatctcgatcaactccagggctttctgcgc
gatccgatcatggcgttgttcgatcagcgcttgcggatcaaggcgccgggcgaggttgtg
gcaccgcccgatgtggagaccttcgcgctcgacggtctcggggactggcagatcaaggac
gaactgatcagccggaccttcgagccggggctggacaggccggcgctggagcagcgtttg
caggcgggtattgcgcgcttccaggctcaggggcggctgccggacgggagtctgggcgag
cgtctggggcggacggtcatcgcctatctgccggttctccatgccgcctgggatgcggct
ctgagcgaatggccccggaggctcgatcgtccgattccggtcatggtggaggtcaatgta
ccggccggtcggctggtgctggaagatgtgttgagcgatctgcgcgagggcgacgatggg
cgcggtcagatcattctgcaaaccagcgggctgaccaaggacaagcattatcagtggcgc
aatacactgcgcgcctgggtgcggcatctggcggctcagctcgatggtgagccggtcacg
acccgcctgctgacgccttcaggcgatgcgcgtctggaacctgtgcccgtcgatgaggcc
cgcgagcggctcgaagcgctgctcgtcgtctggtgggaggggatgcagcggccgttgccg
gttgcgctcaacgccggcatggcctggctcgacaaggacggtcccgagaccctggaggat
ggcacggcgcccgaggaactcaaggcctggaacgcggcccttcaagccttcgatctggat
cacacatacaacgcctatgtcggtcgctgttacgacagcttcgaggcgctctggtccggg
gtggagttcgcgcgctgggcgcatcggctctatggcggtctgcgcacgacgatcagccgc
tag

DBGET integrated database retrieval system