KEGG   Allochromatium vinosum: Alvin_3240Help
Entry
Alvin_3240        CDS       T01168                                 

Definition
(GenBank) helicase, RecD/TraA family
  KO
K03581  exodeoxyribonuclease V alpha subunit [EC:3.1.11.5]
Organism
alv  Allochromatium vinosum
Pathway
alv03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:alv00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    Alvin_3240
Enzymes [BR:alv01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.11  Exodeoxyribonucleases producing 5'-phosphomonoesters
    3.1.11.5  exodeoxyribonuclease V
     Alvin_3240
DNA repair and recombination proteins [BR:alv03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecBC pathway proteins
     Alvin_3240
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AAA_30 AAA_19 HHH_4 UvrD_C_2 HHH_5 Viral_helicase1 AAA_11 Helicase_RecD HHH_2 PIF1 RsgA_GTPase AAA_16 AAA_22 NTPase_1 ArgK T2SSE HHH AAA_29 AAA_24 AAA_28 AAA_25 TrwB_AAD_bind AAA_5 AAA cobW SRP54 NACHT CbiA AAA_18 DUF2075
Motif
Other DBs
NCBI-ProteinID: ADC64132
UniProt: D3RWC0
Position
pALVIN01:90698..92782
Genome map
AA seq 694 aa AA seqDB search
MPATLAPERLTGAVERVTFHSAESGFCVLRVKVRGERELMTVVGSAASVTAGEYLEAEGQ
WITDRQYGLQFKAQQLRIVPPSTLEGIEKYLGSGMVKGIGPHFAKTLVRAFGEAVFEVIE
QQPERLRTLPGIGPKRQERVTRAWAEQKVIRAIMVFLQSHGIGTARAVRIYKTYGEDSVE
RVRENPYRLALDIHGIGFKTADSLAERLGIPRDSLMRAQAGVRHALQEIAGNGHCAAWRE
TLIEQATALLEIPAPLIEQAIDAELDAERLIAESITARAALFLTPLQRAELGVARHVARL
QPGDPPWGRIQTDRAWPWVEERTGLQLSDSQRAAIARVLAAKVAILTGGPGVGKTTVVNS
LLLLLQAKHTRVRLCAPTGRAAKRLSESTGREARTIHRLLEFDPETFGFKHTADNPLDLD
LLVVDEVSMVDVSLMNQLLRAVPDHAGVLLVGDVDQLPSVGPGAVLADLIASGAVVTARL
TDIFRQAEASRIVVNAHRINAGQFPEDPDPERFGLDPVADIQVLTPMNRGGLGARALNGA
LQAALNPTTQPRLERFGWTYAPGDKVIQLVNDYDKEVFNGDIGRVVSIDLEEGEVVIDFE
GRTVVYETGELDALALAYATSIHKSQGSEYPAVVIPLATQHYTLLQRNLLYTAVTRGRRL
VVLIAQPRALAMAVKQTGAGRLTKLRERLQHDAR
NT seq 2085 nt NT seq  +upstreamnt  +downstreamnt
atgcccgccaccctcgcgcccgagcgcctgaccggcgccgtcgagcgcgtgaccttccac
agcgccgagagcggcttttgcgtgctgcgggtgaaggtgcgcggcgagcgcgagctgatg
accgtggtcggctcggcggccagtgtcacggccggtgagtatctggaggccgaaggccag
tggatcaccgatcgccagtacggcttgcagttcaaggcccagcagttgcggatcgtcccg
cccagcacgctggaggggatcgagaagtatctcgggtcggggatggtcaaggggatcggg
ccgcatttcgccaagactctggtgcgggccttcggcgaggcggtattcgaggtcatcgag
cagcagcccgagcggttgcgcacgctgcccggcatcgggccgaagcgtcaggagcgggtc
acgcgggcgtgggccgagcaaaaggtgatccgcgcgatcatggtgttcctgcaatcgcat
gggatcggcacggcgcgggcggtgcgcatctacaagacctatggcgaggactcggtcgag
cgggtgcgcgagaatccctaccggctcgccctcgacatccacggcatcggtttcaagacc
gccgacagtctggccgaacggctcggcatcccgcgcgattcgctgatgcgcgctcaggcc
ggggtgcgccatgcgctccaggagatcgccggcaatggtcactgcgccgcgtggcgtgag
acgctgatcgagcaggccacggcgctgctggagatcccggcaccgctgatcgagcaggcc
atcgacgccgaattggatgcggagcgtctgatcgccgagtcgatcaccgcgcgtgcggcg
ctgtttctcacaccgctccagcgcgccgaactgggtgtggcccggcatgtggcccgactc
cagcccggcgatccgccctggggccggatccagaccgaccgagcgtggccctgggtcgaa
gaacgcaccggattgcagctctcggattcccagcgcgcggccatcgcccgtgtgctcgcg
gccaaggtcgcgatcctcaccggcggccccggcgtcggcaagaccacggtggtcaacagc
ctcctgctcctgcttcaggccaagcacacgcgggtgcgtctctgtgccccgaccggacgc
gcggccaagcggttgagcgaatcgaccgggcgtgaggcgcgcacgattcaccggctgctg
gaattcgatcccgagaccttcggcttcaagcacacggccgacaacccgctcgacctagat
ctgctggtggtcgatgaggtgtcgatggtcgatgtgagcctgatgaaccagttgctgcgc
gccgtgcccgatcacgccggggtgctgctggtcggcgatgtcgatcagttgccatcggtc
ggtccgggtgcggtgctcgccgatctgatcgcgtccggggctgtggtcacggcgcgtctg
accgatatcttccgtcaggccgaagcctcgcgcatcgtggtcaatgcccaccggatcaat
gccggccagttcccggaagatcccgaccccgagcgcttcggtctcgatccggtcgccgac
atccaggtgctgaccccgatgaaccggggcggactcggggcgcgcgccctcaacggcgca
ctgcaagcggcgctcaatccgacgacccagccgcgcctggagcgcttcggctggacctat
gcgccgggcgacaaggtgattcagctggtcaacgactacgacaaggaggtgttcaacggc
gacatcgggcgtgtggtctccatcgacctggaagagggcgaggtggtcatcgacttcgag
ggcaggacggtggtttatgagaccggcgaactcgatgcgctggccttggcctatgccacc
agcatccacaagtcccaggggtcggagtatccggcggtggtcattccgctggccacgcag
cactacacgctgttgcagcgcaatctgctctacacagcggtcacacgcggccggcggctg
gtagtgctcatcgcccagccgcgcgcgctggcgatggcggtcaagcagaccggggccggg
cggctgaccaagctccgggaacggcttcaacatgacgcccgatag

DBGET integrated database retrieval system