KEGG   Arabidopsis lyrata (lyrate rockcress): 9313962
Entry
9313962           CDS       T01578                                 

Definition
(RefSeq) delta(14)-sterol reductase isoform X1
  KO
K00222  Delta14-sterol reductase [EC:1.3.1.70]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00100  Steroid biosynthesis
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
Module
aly_M00917  Phytosterol biosynthesis, squalene 2,3-epoxide => campesterol/sitosterol
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09103 Lipid metabolism
   00100 Steroid biosynthesis
    9313962
Enzymes [BR:aly01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.70  Delta14-sterol reductase
     9313962
SSDB
Motif
Pfam: ERG4_ERG24 DUF1295 OPA3
Other DBs
NCBI-GeneID: 9313962
NCBI-ProteinID: XP_002877894
UniProt: D7LUC6
Position
Unknown
AA seq 373 aa
MLLDMDLGVLLPSLIPSLQSVYVLVFYFVYLAVAGEILPGKVIRGVLLSDGSQPRYRCNG
LLALTLLVAILGICAKIGIVSPLVVADRGLELLSATFIFCVLVTLALYVTGRNSSDKSSS
LKPHVSGNLVHDWWFGIQLNPQFMSIDLKFFFVRAGMMGWLLINLSILAKSVQNGSLSQS
MILYQIFCALYILDYFVHEEYMTSTWDIIAERLGFMLVFGDLLWIPFTFSIQGWWLLHNK
VELTIPAIVANCLVFVIGYMVFRGANKQKHIFKKNPKTPIWGKPPVVVGGKLLASGYWGI
ARHCNYLGDLMLALSFSLPCGVSSPVPYFYPIYLLILLIWRERRDEVRCAEKYKEIWAEY
LRLVPWRILPYVY
NT seq 1122 nt   +upstreamnt  +downstreamnt
atgctgctagatatggatctcggtgttcttctaccatctcttattccctcattgcaatct
gtttatgtgctggtgttttacttcgtttacttggccgttgccggagaaattctccccggg
aaagttattcgcggcgttcttttatcagatggctctcaacctcgttaccgatgcaatggt
ctattggcattaacattgttggtagctattttgggaatctgtgcaaaaattggcattgta
tcacctcttgtggttgcggatagaggacttgagctactctctgctacttttattttctgt
gttttggtgacattagcattgtatgttactgggcgaaattcttccgataagagttcttcc
ctaaagcctcatgtctcaggaaatcttgtacatgattggtggtttggaatacagctgaat
cctcagtttatgagcatcgatctcaagtttttctttgttagagctgggatgatgggatgg
ctgcttattaatctctctattctggcaaaaagtgtgcagaatggttccttgagtcagtcg
atgattctttaccagatcttctgtgcgttatatatattggactactttgttcatgaagaa
tacatgacctctacgtgggacataattgcagagagactgggcttcatgctagtgtttggt
gatctcctgtggattcctttcactttcagcattcagggctggtggcttttgcacaacaaa
gtagaactaacaattcctgctattgtagccaattgccttgtcttcgtaatagggtacatg
gtttttcgaggggctaacaaacaaaaacatatctttaagaagaacccaaaaacacctata
tggggaaagcctccagtggtagttggtggaaagttactggcttcaggctattggggaatt
gcaaggcattgtaattaccttggcgacttgatgcttgctctctccttcagtttgccctgt
ggagtaagttctccggttccatatttctacccaatatatcttctgatactattgatatgg
agagaacgaagagacgaggttcgatgtgcagaaaagtacaaggagatctgggcagagtat
cttagacttgtcccctggagaatacttccttatgtttattag

DBGET integrated database retrieval system