KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_311903Help
Entry
ARALYDRAFT_311903 CDS       T01578                                 

Definition
(RefSeq) T27G7.20
  KO
K03404  magnesium chelatase subunit D [EC:6.6.1.1]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00860  Porphyrin and chlorophyll metabolism
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ARALYDRAFT_311903
Enzymes [BR:aly01000]
 6. Ligases
  6.6  Forming nitrogen-D-metal bonds
   6.6.1  Forming coordination complexes
    6.6.1.1  magnesium chelatase
     ARALYDRAFT_311903
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: VWA_2 Mg_chelatase VWA Sigma54_activat AAA_5 VWA_3 MCM AAA_2 CAP_N Adeno_terminal
Motif
Other DBs
NCBI-GeneID: 9328524
NCBI-ProteinID: XP_002889699
UniProt: D7KIS8
Position
Unknown
AA seq 772 aa AA seqDB search
MAMTPVASSSPVSTCRLFRCNLLPDLLPKPLFLSLPKRNRSASCRFTVRASANATVESPN
GVPASTPETESTSYGRQFFPLAAVVGQEGIKTALLLGAVDREIGGIAISGRRGTAKTVMA
RGLHEIIPPIEVVVGSISNADPACPDEWEDDLDERIEYNADNTIKTEIVKSPFIQIPLGV
TEDRLIGSVDVEESVKRGTTVFQPGLLAEAHRGVLYVDEINLLDEGISNLLLNVLTDGVN
IVEREGISFRHPCKPLLIATYNPEEGAVREHLLDRVAINLSADLPMSFEDRVAAVGIATQ
FQERCNEVFRMVNEETETAKTQIILAREYLKDVKISREQLKYLVLEAVRGGVQGHRAELY
AARVAKCLAAIEGREKVTIDDLRKAVELVILPRSSLDETPPPEQQNQPPPPPPPPQNSES
GEEENEEEQEEEEVSGCGTHYCLSLHTNKDESNEENENEQQQDQIPDEFIFDAEGGLVDE
KLLFFAQQAQKRRGKAGRAKNVIFSEDRGRYIKPMLPKGPVKRLAVDATLRAAAPYQKLR
REKDITGTRKVFVEKTDMRAKRMARKAGALVIFVVDASGSMALNRMQNAKGAALKLLAES
YTSRDQVSIIPFRGDAAEVLLPPSRSIAMARNRLERLPCGGGSPLAHGLTTAVRVGLNAE
KSGDVGRIMIVAITDGRANITLKRSTDPDSIAPDAPRPTSKELKDEILEVAGKIYKAGMS
LLVIDTENKFVSTGFAKEIARVAQGKYYYLPNASDAVISATTRDALSDLKNS
NT seq 2319 nt NT seq  +upstreamnt  +downstreamnt
atggcgatgactccggtcgcgtcatcatctccagtgtcaacgtgcagactctttcgctgc
aatctcctccccgatctcttacctaagcctctgtttctttccctccccaaacgaaacaga
agtgcgtcgtgccgcttcactgtacgtgcctccgcgaatgctaccgtcgaatccccaaac
ggtgtccctgcctcgacaccagagacggagagcacctcctatggccgacagtttttccct
ttggccgcagttgttggccaggaaggcatcaaaactgctcttttacttggcgctgttgat
cgtgaaatcggagggattgctatctcaggtcgtagaggcactgcaaaaacagtcatggca
cgagggctacatgaaatcattcctcctatagaagttgttgtaggctcaatatcaaatgct
gacccagcttgccctgatgagtgggaagacgacttagatgagcgaatagagtacaatgct
gataataccattaagactgagattgtcaaatctcctttcattcagattcctctaggtgtc
acagaagatagactcattgggtctgttgatgttgaggagtctgtgaaaagggggacaact
gttttccaacctggtcttttggctgaagcccatagaggagtgttgtatgttgatgaaata
aatctcttagatgagggaattagtaatttgcttctcaatgtattgacggatggtgttaat
atagttgaaagagaaggaatcagctttaggcacccgtgcaaaccacttttaattgcaact
tataaccctgaagaaggtgctgttcgagagcacttgctagaccgtgttgccattaattta
agtgcagaccttcctatgagttttgaagatcgcgtcgcagcagttggaattgccacacag
tttcaggaacgctgtaatgaggtttttagaatggtaaatgaagagacagagacagcaaag
acgcagatcatattggctagagaatatttgaaagatgtcaagataagtagagagcaattg
aagtatctggttttggaagctgtccgaggtggtgttcagggacaccgcgccgaattgtat
gcagctcgtgtggcaaagtgtttagctgcaattgaagggcgagaaaaagtcacaattgat
gacctcagaaaggccgttgagctggtcattcttcctcgttcatcactagatgagactcct
ccacctgaacaacaaaaccaaccgccacctccgccacctcctccacaaaatagcgaatct
ggagaagaagaaaatgaagaagaacaagaagaagaagaggtcagtggatgcggtacacat
tattgtctctcgttgcacacaaacaaggatgaaagcaatgaagaaaatgaaaatgagcag
caacaagaccaaatacctgacgagtttatatttgacgctgagggcggtctggtggatgaa
aaactcctcttctttgctcaacaagcccagaaacgtcgggggaaagccggcagagcgaag
aatgtcatattctcagaagatagaggacgctatataaagccaatgcttccaaagggtcca
gtaaaaagattagctgtggatgcaacccttagagcagctgcaccataccagaaattgcgc
agagagaaggatattacaggaactaggaaagtctttgttgagaagacagatatgagggcc
aaaagaatggctaggaaagctggagccctggttatctttgtggttgatgcaagtggcagt
atggcattgaatcgtatgcaaaacgccaaaggtgctgcactcaaactactggcagagagc
tatactagtagggatcaggtttcgattattcctttccgaggagatgctgcggaagtgctc
ttgcccccttctagatcaattgcaatggcaaggaatcgtcttgagagacttccttgtggt
ggtggttctcctcttgcccatggtttaacaacggctgtaagagttggacttaacgcagag
aagagtggtgatgtcgggcgaataatgattgttgcgataaccgatggtcgagccaacatt
acactgaaaagatcaactgatccagactctattgccccagatgctcctagacccacgtcc
aaagaattgaaggatgagattctggaagttgctgggaagatatacaaggcagggatgtct
cttctagtgattgatactgagaacaagtttgtttcaactggttttgcaaaggagatcgca
agagttgctcaaggaaaatactattacttgccaaatgcttcggacgctgtcatctcggcc
accacgagggatgcactatctgatctgaagaattcttga

DBGET integrated database retrieval system