KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_312030Help
Entry
ARALYDRAFT_312030 CDS       T01578                                 

Definition
(RefSeq) histidine acid phosphatase family protein
  KO
K03103  multiple inositol-polyphosphate phosphatase / 2,3-bisphosphoglycerate 3-phosphatase [EC:3.1.3.62 3.1.3.80]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00010  Glycolysis / Gluconeogenesis
aly00562  Inositol phosphate metabolism
aly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    ARALYDRAFT_312030
   00562 Inositol phosphate metabolism
    ARALYDRAFT_312030
Enzymes [BR:aly01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.62  multiple inositol-polyphosphate phosphatase
     ARALYDRAFT_312030
    3.1.3.80  2,3-bisphosphoglycerate 3-phosphatase
     ARALYDRAFT_312030
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: His_Phos_2
Motif
Other DBs
NCBI-GeneID: 9328594
NCBI-ProteinID: XP_002889774
UniProt: D7KJV4
Position
Unknown
AA seq 487 aa AA seqDB search
MATKTVWIILLCLFVVSQADQGFDVRHHLSTVTRYSVSKDVTQNLIEGSNVPSECTPIHL
NLVARHGTRSPTKKRLRELENLAGRLKELVRDAEARKLPSDKIPGWLGQWKSPWEGKVKG
GELIRQGEDELYQLGIRVRERFPSLFEEDYHPDVYTIRATQIPRASASAVAFGMGLFSEK
GNLGPGRNRAFAVTSENRASDTKLRFFECCQNYKSYRKAKEPAVDKLKEPVLNKITASVA
KRYDLKFTKQDISSLWFLCKQEASLLNITNQSCELFTPSEVALLEWTDDLEVFLLKGYGN
SLNYKMGVPLLEDVLHSMEEAIKAREEKLPPGSYEKARLRFAHAETIVPFSCLLGLFLDG
SEFERIQKEKPLELPPQPPKTRDFRGSTMAPFGGNNILVLYSCPAESSPKYFVQVLHNEH
PIAVPGCDGKDFCSLEDFKAKVVTPHLKHAFDNLCNADLNDLKQKPASSKLSILSSWLFG
SSQDTEL
NT seq 1464 nt NT seq  +upstreamnt  +downstreamnt
atggcgacgaagactgtttggatcatactgttgtgtctatttgttgtttcacaggcggat
cagggtttcgatgttcgtcatcacctctccaccgtcaccagatactctgtttcgaaagat
gttacccaaaatttgattgaagggtcgaatgttcccagtgagtgtacacctatccacctt
aaccttgtggctaggcatggaactcgttctccgaccaagaaacggttgcgggaattggag
aatttggctggtaggttaaaggaattggtaagagatgcagaagctaggaaattgccttca
gacaaaattcctggatggttaggacaatggaaatctccctgggaaggaaaagtgaaaggc
ggggagctgatcaggcaaggggaggacgagttgtaccaactgggaatccgggttcgggaa
cggtttcctagtttgtttgaagaggattaccaccctgatgtctatacaataagagctacg
cagattcctcgggcttctgcaagtgctgtagcatttggaatggggttattcagtgagaaa
ggaaatctgggaccaggccgtaatagagcattcgctgtcactagtgaaaaccgtgcaagt
gatacaaagttgagattttttgaatgttgtcaaaactacaagagctatagaaaagctaaa
gagcctgctgtggataagctcaaggaacctgttctgaataagattacagcttccgttgca
aagagatatgatttaaaatttacaaaacaggacatttcttctctctggtttctgtgcaag
caggaagcatcattgcttaatataactaatcaaagttgtgaacttttcacgccatcagag
gttgctttactggaatggacagatgacttggaagtgtttctcctcaaaggttatggcaat
tccttaaactacaaaatgggagttccactactagaagatgttttgcattcaatggaagaa
gctatcaaggcccgggaagaaaagctcccacctggaagttacgaaaaagcaaggcttagg
tttgcacatgcagaaacaatagttcccttttcttgtcttcttgggcttttccttgatgga
tctgagtttgagagaatacagaaggagaaacctttggaactccctccacagcctcccaaa
accagggattttagaggcagcaccatggctccttttggtgggaacaacattcttgtccta
tacagttgtcccgcagaatcctctcccaaatacttcgttcaggttctgcacaatgagcat
cctattgcagttccaggttgtgatggaaaagatttctgttctcttgaagattttaaggcc
aaagtggtaacccctcatctaaagcatgcttttgacaacctctgcaatgctgatctaaat
gacctgaaacagaagcctgcatcaagtaagttatctatactgtcaagttggctgtttggg
tcaagccaggataccgagctctag

DBGET integrated database retrieval system