KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_315394Help
Entry
ARALYDRAFT_315394 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00450  Selenocompound metabolism
aly00970  Aminoacyl-tRNA biosynthesis
aly01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:aly00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    ARALYDRAFT_315394
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    ARALYDRAFT_315394
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:aly01007]
    ARALYDRAFT_315394
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:aly03016]
    ARALYDRAFT_315394
Enzymes [BR:aly01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     ARALYDRAFT_315394
Amino acid related enzymes [BR:aly01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   ARALYDRAFT_315394
Transfer RNA biogenesis [BR:aly03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    ARALYDRAFT_315394
 Prokaryotic type
   Other AARSs
    ARALYDRAFT_315394
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 Anticodon_1
Motif
Other DBs
NCBI-GeneID: 9324290
NCBI-ProteinID: XP_002886697
UniProt: D7KY75
Position
Unknown
AA seq 713 aa AA seqDB search
MEDESKIVPKLPILGKRNILITSALPYVNNVPHLGNIIGCVLSADVYARYCRLRGYNTIY
ICGTDEYGTATETKALEENCTPKEICDKYHAIHQVYDWFDISFDKFGRTSTPETKVCQEI
FNKLWENEWISEDTMKQPYCDTCKKFLADRLVCKTTPGFRDTDHLFLELPLLKYKLKKYI
KETSSSGSWSRNAIQTTDASLKEVPNDSEKDGLKKRCITRDLKWGVPVPHEKYKEKVFYV
WFDAPIGYVSITSCYTSEWEKWWKNPENVELYQFMGKDNVFFHTVLFPCTHLGTGEDWTM
MKTVSVTDYLNYEGGKFSESKGVGVFGNDVKDTNIPVEVWRYYLLTNRPEKSDTTFKWDD
FQKKLNHELLANLGNFVYLVLSFIAKPKNKGGYGSLAEYAGKLVEDYVKVMEKVKLKKGL
HTTMLLSNEGNTYLQDTNFWELYKKDKPSCAVVIRTAAGLVHLLARLLEPFMPSFSREVF
KQLNLPPHFSLSEEKGEVLQASSLWEILPSNHRIGTPQPLFKKMEEEEMKHYREKFAGSQ
ADRLARDREITMARLDIRVGKIVKAEKHPKADALYVEEIDVGEDQLYTVVSGLVKYIPLE
EMQNRLVCVLCNLKPAKMREIVSQGMVLATSSSDGSKVELVEPPESSKIGERVKIPGFEG
EPDNVLNPKTKIWEKLVVDLHTNENLVACYKNLPFTTSAGECKVSSISNGTIR
NT seq 2142 nt NT seq  +upstreamnt  +downstreamnt
atggaagacgaaagcaagatcgtccccaagttgccaatcctaggcaagagaaatatacta
atcacaagtgctttgccttacgtcaacaacgtaccacatctaggaaacatcattggttgt
gttctaagtgctgatgtctacgctagatattgtcgtctacgtggctataacacaatctac
atatgtggaaccgatgaatatggaactgcaacagagacaaaagctttagaggaaaattgt
acaccgaaagagatttgtgacaagtaccatgcaattcatcaagtttatgattggtttgat
ataagttttgataagtttggtcgaacttcaactcctgagacaaaagtttgtcaagagatt
ttcaacaagttgtgggaaaacgaatggatttctgaagatactatgaaacaaccttattgt
gatacatgcaagaagtttttagctgatcgtcttgtttgtaaaaccacacccgggtttcgc
gacacggaccatttgtttcttgagcttcccttgctgaaatataagttgaaaaagtatatt
aaagagacatctagtagtggatcttggagtcggaatgctattcaaacgacggatgcatcg
cttaaggaagtgcctaacgatagcgaaaaggacgggcttaagaagagatgcatcacaagg
gatttaaagtggggagttccagttccacatgagaaatataaggaaaaagtcttctacgtt
tggtttgatgctcctattggttatgtttcgataacttcatgttacacatcggaatgggag
aagtggtggaagaatcctgagaatgttgagctttatcagtttatggggaaagataatgtg
ttttttcacactgtcttgtttccttgtacgcatcttggaactggtgaagattggactatg
atgaagacagttagtgtgactgattatttaaattacgaaggcggaaagttttcggagagt
aaaggtgttggagtgtttggtaatgatgtgaaagatacaaatatccctgtcgaagtatgg
agatactacttgctgaccaacaggccagagaagtctgatacaacatttaaatgggatgat
ttccaaaagaaacttaatcacgagttgctagcgaaccttggaaactttgtttatctagtt
ttgagttttatagcaaagcctaaaaataaaggaggttatggatcacttgctgaatatgct
ggaaaattggtggaggactatgttaaagttatggaaaaagttaagctcaagaaagggctt
cataccacaatgctcttatcgaatgaagggaacacatacttgcaggataccaatttttgg
gaactctacaaaaaagataaaccgtcttgtgcagttgttataagaactgctgctggttta
gtacaccttcttgcacgattgttagaacctttcatgccatctttttctcgtgaggtattt
aaacagctgaatttgccaccacatttttcactctccgaagagaaaggagaggtattacaa
gcaagtagtctttgggagattcttccttccaaccacaggattggaacacctcaaccattg
ttcaagaaaatggaagaggaagagatgaaacattacagagaaaagtttgctggaagtcaa
gctgatagacttgctagggatcgcgaaattaccatggcaagacttgatattcgagttggt
aagattgtgaaggctgagaaacatcctaaagcagatgcattgtatgtggaagagattgat
gttggagaagatcaactttacactgttgttagtggactagttaagtatatacctcttgag
gagatgcagaaccgtttggtttgtgttctttgcaacttgaagccggcgaaaatgagggag
attgtgtcacaaggaatggttcttgccacttctagtagtgatggtagcaaggtggagtta
gttgagccccctgaatcttctaagattggagagcgagttaagattcccgggtttgaaggc
gagccagacaatgtcttaaacccgaagacgaaaatatgggagaaacttgtagtggatcta
cacacaaatgagaatttagttgcttgctacaaaaatttacccttcactacatctgcaggt
gaatgcaaagtttcatccattagcaatggcacaatccgataa

DBGET integrated database retrieval system