KEGG   Arabidopsis lyrata (lyrate rockcress): ARALYDRAFT_339208Help
Entry
ARALYDRAFT_339208 CDS       T01578                                 

Definition
(RefSeq) hypothetical protein
  KO
K01698  porphobilinogen synthase [EC:4.2.1.24]
Organism
aly  Arabidopsis lyrata (lyrate rockcress)
Pathway
aly00860  Porphyrin and chlorophyll metabolism
aly01100  Metabolic pathways
aly01110  Biosynthesis of secondary metabolites
Module
aly_M00121  Heme biosynthesis, glutamate => heme
Brite
KEGG Orthology (KO) [BR:aly00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    ARALYDRAFT_339208
Enzymes [BR:aly01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     ARALYDRAFT_339208
Exosome [BR:aly04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   ARALYDRAFT_339208
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ALAD
Motif
Other DBs
NCBI-GeneID: 9324795
NCBI-ProteinID: XP_002887254
UniProt: D7KXI7
Position
Unknown
AA seq 430 aa AA seqDB search
MATTPIFNASCSFPSTRGIDCKNYIGLRSNVSKVSVASSRIATSQRRNLVIRASESGNGH
AKKLGMSDAECEAAVAAGNVPEAPPVPPKPAAPIGTPIIQPLNLSRRPRRNRASPVARAA
FQETDISPANFVYPLFIHEGEEDTPIGAMPGCYRLGWRHGLVQEVAKARAVGVNSIVLFP
KVPEALKNPTGDEAYNDNGLVPRTIRLLKDKYPDLVIYTDVALDPYSSDGHDGIVREDGV
IMNDETVHQLCKQAVSQARAGADVVSPSDMMDGRVGAIRAALDAEGFQNVSIMSYTAKYA
SSFYGPFREALDSNPRFGDKKTYQMNPANYREALIEAREDEAEGADILLVKPGLPYLDII
RLLRDKSPLPIAAYQVSGEYSMIKAGGVLKMIDEEKVMMESLMCLRRAGADIILTYFALQ
AATCLCGEKR
NT seq 1293 nt NT seq  +upstreamnt  +downstreamnt
atggctactacaccgatttttaatgcctcgtgtagctttccatcgaccagaggaatcgat
tgtaagaactatattggtctgagatcgaatgtgagtaaagtgagtgtggcttcttctcga
attgcaactagtcaacgtcgtaatcttgtcataagagctagtgaatctggcaatggacac
gctaagaaacttggaatgagtgatgctgagtgtgaagccgctgttgctgctggaaatgtt
cctgaagctcctccggttccacctaaacccgctgctccaattggtacaccgataattcag
cctcttaatctaagccgacgcccacgtcgtaaccgtgcttcccctgtggcgagagccgcc
tttcaagaaactgatatctcccctgcaaattttgtatacccacttttcattcatgaaggt
gaggaagacacgcctattggagctatgcccggttgctatagacttggctggaggcatggt
cttgtacaagaggttgcaaaggctcgagctgttggtgtaaacagtatcgtcctgttccct
aaagttcctgaggctttgaagaatccaacaggagatgaggcatacaatgacaatggtttg
gtgcctcgaacaattcgtcttcttaaagacaaatatcctgatcttgttatctacactgat
gtggctttggatccctactcatccgatggtcacgatggaatagttagagaggatggtgta
attatgaatgacgaaacggtacatcagctgtgtaagcaagctgtttcccaggcccgagct
ggagcggacgttgtcagtccgagtgatatgatggatgggcgagtaggtgcaatccgtgca
gctcttgatgctgaaggatttcaaaacgtctccatcatgtcctacacagccaagtatgca
agttcgttttacggtcctttccgtgaagccctggactccaatccacgtttcggagacaag
aaaacgtatcagatgaacccagcaaattacagagaggccttgattgaggcacgtgaagac
gaggctgagggagcagacattcttctggtgaagccaggtcttccatatttggacatcata
cggcttctgagggacaaatctccattgcccattgctgcataccaagtttctggagagtac
tcaatgatcaaagcagggggagttctgaagatgatcgatgaagagaaagtgatgatggag
tcactgatgtgcttacgccgagctggagcggacatcatcctaacatacttcgctcttcaa
gctgctacttgtttatgcggcgagaagcggtag

DBGET integrated database retrieval system